DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc23b

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001003757.1 Gene:zdhhc23b / 445301 ZFINID:ZDB-GENE-040808-13 Length:425 Species:Danio rerio


Alignment Length:211 Identity:57/211 - (27%)
Similarity:86/211 - (40%) Gaps:63/211 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DPGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVG 159
            :||       |:|  |:.|.::...   |..|..::|.||.||.:|..|:.::||||.|:|:|||
Zfish   233 EPG-------TEE--EEEGVQKRNW---CAVCKVVRPRRAGHCRICGVCVLRLDHHCVWINSCVG 285

  Fly   160 ENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWR---------------------TCSPYS 203
            ..|.:.|:|...:....|:..:.|||..    |..|.|                     ||:.||
Zfish   286 LANHRTFLLTLLFFLLTSIFGISLVLAS----VCPDQRVLTALFYCPDVYSQYSSALCFTCAWYS 346

  Fly   204 PPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEEARWA--KKSRLKSIQSVF 266
            ...|..||..|                  |..|||....:.:   .|||.|  :||..:.:..:.
Zfish   347 SIVTGGLLHLL------------------LLQILNISLNVTE---REARLALREKSAQRRLWGLI 390

  Fly   267 ---GRFSLAWFSPFTE 279
               |.:|..::|.:||
Zfish   391 VHTGHYSRGFWSNWTE 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 40/147 (27%)
zdhhc23bNP_001003757.1 7TMR-DISM_7TM <62..179 CDD:284997
zf-DHHC <244..>350 CDD:303066 32/112 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.