DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and CG5880

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:194 Identity:62/194 - (31%)
Similarity:91/194 - (46%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNYSYSA---LSPGGSGGFGGVDQHNRCCGNKAWCVKDICGI---VCVIMTWLLILF---AEFVV 56
            ||.||::   |:|    .|..||.:..|.|  .:.|..:..:   |..|..|:.:.|   ...:|
  Fly    38 MNSSYASDVCLTP----IFWFVDNYTHCLG--PFFVVGVAALTTSVVSIAYWIGLPFWWAKSQLV 96

  Fly    57 MRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRGNATKEMIEQMGYREGQMFY 121
            ...:|:..|:.:   :|::....:|.:..|.|          .|.|.:..|.:..          
  Fly    97 TYFLLIVGNWLL---LNVVFHYVMAVITPAGH----------PPEGVSLVEAVSM---------- 138

  Fly   122 KCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVL 185
             |.||.:.||.|.||||:|.|||.||||||||:|||||..|.:||.|:..|   .::..|||:|
  Fly   139 -CGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVGYGNHRYFFLYMTY---TTLGCLFLIL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 36/64 (56%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 36/63 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.