DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and CG17197

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_651425.2 Gene:CG17197 / 43111 FlyBaseID:FBgn0039367 Length:290 Species:Drosophila melanogaster


Alignment Length:228 Identity:56/228 - (24%)
Similarity:99/228 - (43%) Gaps:54/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IVCVIMTWLLILFAEFVVMRLI-LLPSNYTVFSTINMIIFQALAFLAF-------ASHIRTMLSD 95
            ::.||:|.:.     |||:::. ::|..:.|...:..:.:....|:.:       |.||.:  :.
  Fly    28 VLFVIVTTIF-----FVVLQMFYVVPQLFDVQGFMYKLGWLVAIFITYNIFGNMLACHITS--TS 85

  Fly    96 PGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGE 160
            ..::|:.....|..|     |.|..| |..|..:.|.|:.||.:|:.||.|.|.||.:..:|||.
  Fly    86 VESLPKDRQIPEPEE-----EHQWHY-CDVCEKLMPPRSWHCILCKCCILKRDRHCIFTASCVGH 144

  Fly   161 NNQKYFVLFTFYIA-----SISVHTLFLVLTQFAECVKNDWRTCSPYS------------PPATI 208
            |||:||..||.::|     :::.| :...|..|:            ||            ||..:
  Fly   145 NNQRYFFWFTLFMALGTGVALATH-IIATLKYFS------------YSDLIFLNIPRDNLPPFWL 196

  Fly   209 FLLLFLTFEGLMFGIFTIIMLATQLTAILNDQT 241
            .:.|.|........:.:::|   ||:.:.|:.|
  Fly   197 VITLILNTYVFAAPVSSVLM---QLSVLKNNGT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 38/137 (28%)
CG17197NP_651425.2 PHA02688 <9..70 CDD:222919 9/46 (20%)
zf-DHHC 100..>198 CDD:279823 35/116 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467532
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.