DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and app

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster


Alignment Length:284 Identity:77/284 - (27%)
Similarity:115/284 - (40%) Gaps:82/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CCGNKA--------WCV-----KDICG-------------IVCVIMTWLLILFAEFVVMRLILLP 63
            ||.|.|        |.:     |..|.             :.|:::|....||..|....|.   
  Fly     8 CCSNMAPNQRVTRKWELFAGRNKFYCDGLLMSAPHTGVFYLTCILITGTSALFFAFDCPFLA--- 69

  Fly    64 SNYTVFSTIN---MIIFQALAFLAFASHIRTMLSDPGAVPRGN---------------------- 103
                  .:||   .|:...|.|...:|.:||..:|||.:||.:                      
  Fly    70 ------DSINPAIPIVGAVLYFFTMSSLLRTTFTDPGVIPRASNDEAAYIEKQIEVPNSLNSPTY 128

  Fly   104 ----ATKEMIEQMGYREGQ---MFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGEN 161
                .|||::.     :||   :.| |..|...:|.||.|||:|..|:.:.|||||||.||||:.
  Fly   129 RPPPRTKEVLV-----KGQTVKLKY-CFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGKR 187

  Fly   162 NQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTI 226
            |.::|.||...:|.::|......:|.....:|.:....:.........:::|:.|    |.|:::
  Fly   188 NYRFFYLFLVSLAFLAVFIFSCSVTHLVLLMKKEHEVFNVIKAAPFTVIVVFICF----FSIWSV 248

  Fly   227 IMLA---TQLTAILNDQTGIEQLK 247
            |.||   |.||.  :|||..|.||
  Fly   249 IGLAGFHTYLTT--SDQTTNEDLK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 45/129 (35%)
appNP_648561.2 zf-DHHC 146..270 CDD:279823 44/130 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467530
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.