DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and CG17287

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:275 Identity:75/275 - (27%)
Similarity:115/275 - (41%) Gaps:70/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSPGGSGGFGGVDQHNR--CCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFS 70
            :.|.|.|       |.|  ||..: |..      ..:|:.:|:..:..||....|...|:|.   
  Fly     1 MCPIGEG-------HRRVPCCAVR-WLP------ALIILGFLVWSYHVFVYQICIKKVSDYL--- 48

  Fly    71 TINMIIF--QALAFLAFASHIRTMLSDPGAVP--------------RGNATKEMIEQMGYR---- 115
            ||.:::|  ..|.|:...:..|.:...|..:|              |.:..:.....:.|.    
  Fly    49 TIGLLLFFYHLLLFMFLWTWFRCIFVAPVRIPDQWKISPEDVDKLKRNDGIEGASRVLNYAARNL 113

  Fly   116 -------EGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLF---- 169
                   :|.:.| |..|..|||:|||||..|..|:.||||||||:.|||..:|.|||:||    
  Fly   114 PIATCTIDGLVRY-CKTCWIIKPDRAHHCRTCHMCVLKMDHHCPWIVNCVHFHNFKYFILFLFYA 177

  Fly   170 ---TFYIASISVHTLFLVLTQFAECVKN--DWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIML 229
               .||:..:.|:.|:|:.......:||  .|.            :|.:|..  ::|.|||:||.
  Fly   178 EVYCFYLFCVMVYDLYLICGFEVTALKNQHSWN------------ILQYLVC--ILFNIFTVIMY 228

  Fly   230 ATQLTAILNDQTGIE 244
            ...|..:..::|.:|
  Fly   229 TVSLLNVSRNRTTME 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 48/132 (36%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 48/132 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467475
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.