DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001013257.1 Gene:Zdhhc12 / 366014 RGDID:1306593 Length:267 Species:Rattus norvegicus


Alignment Length:275 Identity:70/275 - (25%)
Similarity:115/275 - (41%) Gaps:76/275 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IMTW--LLILFAEFVVMRL------ILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAV 99
            ::||  .|:||.....:|.      :.||..:.:     :::...|.:||.:      |.|||.|
  Rat    19 VLTWGITLVLFLHDTELRQWEEQGELFLPLTFLL-----LVLGSLLLYLAVS------LMDPGYV 72

  Fly   100 ---------PRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVN 155
                     |:...|..:.:.:..|      :|..|..::|.||.||..|:||:|:.||||||:.
  Rat    73 TAQPQPQEEPKEEQTAMVPQAIPLR------RCRYCLVLQPLRARHCRECRRCVRRYDHHCPWME 131

  Fly   156 NCVGENNQKYFVLFTFYIASISVHTLFLVLT--QFAECVKNDWRTCSPYSPPATIFL----LLFL 214
            |||||.|...||.:......:.:..|:|..:  ||.:              |..::|    |||.
  Rat   132 NCVGERNHPLFVAYLALQLVVLLWGLYLAWSGLQFFQ--------------PWGLWLRSTGLLFT 182

  Fly   215 TFEGLMFGIFTII---MLATQLTAILNDQTGIEQLKKEEARWAKKSRLKSIQSVFGRFSLAWFSP 276
            ||  |:...|.::   :||:.|..:..:.|..|.:......:.::           |.|    :|
  Rat   183 TF--LLLSFFALVVSLLLASHLYLVARNTTTWEFISSHRIAYLRQ-----------RTS----NP 230

  Fly   277 FTEPSCRTRFNSHFY 291
            |....  ||..:||:
  Rat   231 FDRGP--TRNLAHFF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 43/135 (32%)
Zdhhc12NP_001013257.1 DHHC <123..217 CDD:396215 32/109 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.