DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and CG4676

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster


Alignment Length:266 Identity:61/266 - (22%)
Similarity:116/266 - (43%) Gaps:61/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 FAEFVVMRLILLPSNYTVFSTINM------------IIFQALAFLAF---ASHIRTMLSDPGAVP 100
            ||.|::: .:.:|..|....||.|            :::.|..||.|   ::.:..||.|.    
  Fly    18 FACFLLV-AVFVPVTYIFHVTIVMPELFAIGGIWYTLLWLASLFLIFNITSNMLACMLVDT---- 77

  Fly   101 RGNATKEMIE-QMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQK 164
              :..||::: .:...:...::.|..|.::.|.|:.||.||..|:.|.||||.:...|:|.:|.:
  Fly    78 --SIRKELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVLKRDHHCRFTCCCIGHHNYR 140

  Fly   165 YFVLFTFYIASISVHTLFLVLTQFAECVKND-----------WRTCSPYSPPATIF-----LLLF 213
            ||    ||      :.:::::...|..:...           ||    :|...|||     |:|.
  Fly   141 YF----FY------YLVYMIIGSLAAAIMESIYLWHLHLDIYWR----WSTLFTIFAPVVSLMLS 191

  Fly   214 LTFEGLMFGIFTIIMLATQLTAIL------NDQTGIEQLKKEEARWAKKSRLKSIQSVFG-RFSL 271
            .::|.....|:.:.:|...::::|      ..::|....::...::.:..| .:::.|.| |..|
  Fly   192 PSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTRKYDRGLR-GNLEMVLGKRMHL 255

  Fly   272 AWFSPF 277
            .|.|||
  Fly   256 TWLSPF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 35/148 (24%)
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 35/146 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467535
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.