DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_038966311.1 Gene:Zdhhc18 / 362613 RGDID:1309334 Length:482 Species:Rattus norvegicus


Alignment Length:297 Identity:83/297 - (27%)
Similarity:121/297 - (40%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YSYSALSPGGSGGFGGVDQHNR------------CCGNKAWCVKDICGIVCVIMTWLLILFAEFV 55
            :|.|....|...|.|.:.:..|            .||.:..    :.|...|....||::.:..:
  Rat    44 WSVSGSGSGSGSGSGSLGRRPRRKWEVFPGRNRFYCGGRLM----LAGHGGVFALTLLLILSTTI 104

  Fly    56 VMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRGN-----ATKEMIEQMG-- 113
            :..:...|......:....||...|.|...:..::|..:|||.:||..     |.::.|:..|  
  Rat   105 LFFIFDCPYLARTLTLAIPIIAAILFFFVMSCLLQTSFTDPGILPRATICEAAALEKQIDNTGSS 169

  Fly   114 -YR----------EGQM--FYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKY 165
             ||          .|||  ...|..|...:|.|..|||||..|:.:.|||||||.||||..|.::
  Rat   170 TYRPPPRTREVMINGQMVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGRRNYRF 234

  Fly   166 FVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYS--------PPATIFLLLFLTFEGLMFG 222
            |..|   |.|:|..|.|:    || ||.......|..|        .||:: |.|.:.|    |.
  Rat   235 FYAF---ILSLSFLTAFI----FA-CVVTHLTLLSQGSNFLSALKKTPASV-LELVICF----FS 286

  Fly   223 IFTIIMLA---TQLTAILNDQTGIEQLKKEEARWAKK 256
            |::|:.|:   |.|.|  ::.|..|.:|   ..|:.|
  Rat   287 IWSILGLSGFHTYLVA--SNLTTNEDIK---GSWSSK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 50/137 (36%)
Zdhhc18XP_038966311.1 DHHC 189..312 CDD:396215 49/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.