DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc6

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001032741.1 Gene:Zdhhc6 / 361771 RGDID:1304657 Length:413 Species:Rattus norvegicus


Alignment Length:271 Identity:73/271 - (26%)
Similarity:109/271 - (40%) Gaps:65/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGAVPRG 102
            |::.:..|..:|   :.|:....|    :|...::|.|:......:...::...|.:.||.||||
  Rat    29 GVIAICSTMAMI---DSVLWYWPL----HTTGGSVNFIMLINWTVMILYNYFNAMFAGPGFVPRG 86

  Fly   103 ----NATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQ 163
                |....|..|.          |..|.:.|..|:|||..|.||:.||||||||:|||.|..|.
  Rat    87 WKPENPQDSMYLQY----------CKVCQAYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHQNH 141

  Fly   164 KYFVLFTFYIASISVHTLFL-VLTQFAE----------CVKNDWRTCSPYSPP----------AT 207
            ..|.||.........|..|: |:|.:.:          .||.|........||          ||
  Rat   142 ASFTLFLLLAPLGCTHAAFIFVMTMYTQLYNRLSFGWNTVKIDMSAARRDPPPIVPFGLAAFAAT 206

  Fly   208 IFLLLFLTFEGLMFG--IFTIIMLATQLTAILNDQTGIEQLKKEEAR---------------WAK 255
            :|.|      ||..|  |...::...|:..||.::|.||...:|:|:               :..
  Rat   207 LFAL------GLALGTTIAVGMLFFIQIKIILRNKTSIESWIEEKAKDRIQYYQLDEVFVFPYDM 265

  Fly   256 KSRLKSIQSVF 266
            .|:.|:::.||
  Rat   266 GSKWKNLKQVF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 49/149 (33%)
Zdhhc6NP_001032741.1 DHHC 95..241 CDD:396215 51/161 (32%)
SH3_2 317..394 CDD:400139
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.