DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and CG1407

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:307 Identity:87/307 - (28%)
Similarity:123/307 - (40%) Gaps:58/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFV--------VMRLILLPSNYTVFSTINM 74
            |.|.|.|        .|..||....:..|:.:||...|        |:.|.:..|...: ..|.|
  Fly     2 GNDDHRR--------RKTPCGFCMAVFKWIPVLFITAVIAWSYYAYVVELCIRNSENRI-GMIFM 57

  Fly    75 IIFQALAFLAFA-SHIRTMLSDPGAVP-------------------------RGNATKEMIEQMG 113
            ::|..|....|. |:.||:::..|.:|                         ..|..:::.....
  Fly    58 LLFYHLFLTLFMWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNR 122

  Fly   114 YREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISV 178
            ...|.:.: |.||..|||:||||||||..|:.|||||||||||||...|.||||||..|.....:
  Fly   123 TMNGSVRF-CEKCKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCL 186

  Fly   179 HTLFLVLTQFAECVKNDWRTCSPYSPPATI-------FLLLFLTFEGLMFGIFTIIMLATQLTAI 236
            :..|..|..|.|..|......:.||....:       |.:|||.|..:||.|..:.:....:..:
  Fly   187 YVAFTSLHDFVEFWKVGAYDNNGYSAQGQLNASGMGRFHILFLFFIAIMFAISLVSLFGYHIYLV 251

  Fly   237 LNDQTGIEQLKK-------EEARWAKKSRLKSIQSVFGRFSLAWFSP 276
            |.::|.:|..:.       .:.......|..:...|||.....||.|
  Fly   252 LVNRTTLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFLP 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 54/140 (39%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 53/130 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467474
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.