DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001259382.1 Gene:Zdhhc8 / 31887 FlyBaseID:FBgn0085478 Length:1052 Species:Drosophila melanogaster


Alignment Length:262 Identity:65/262 - (24%)
Similarity:113/262 - (43%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WLLILFAEFVVMRLILLPSNYTVFSTINMIIFQ-ALAFLAFASHIRTMLSDPGAVPRGNATKEMI 109
            |:::|...|:   ....|..:.|.|...::.:| .:.|...|:.......|||.:|:.:..::..
  Fly    17 WIVLLLTTFL---FFFYPCQFYVKSHPWVLAYQGVITFFVLANFTLATFMDPGIIPKASPDEDCE 78

  Fly   110 EQMG---YREGQM------FYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKY 165
            |::.   |:..::      ...|..|...:|.|..|||||..||...||||||||||:|..|.::
  Fly    79 EELRAPLYKNAEINGITVKMKWCVTCKFYRPPRCSHCSVCNHCIETFDHHCPWVNNCIGRRNYRF 143

  Fly   166 FVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLA 230
            |.   |::.|:|:|    :|:.|:.|:....:........|.|..:       ::.|:.||  ||
  Fly   144 FF---FFLVSLSIH----MLSIFSLCLVYVLKIMPNIKDTAPIVAI-------ILMGLVTI--LA 192

  Fly   231 TQLTAILNDQTGIEQLKKEEARWAKKSRLKSIQSVFGRFSLAWFSPFT----EPSCRTRFNSHFY 291
            ..:..:    ||...:.....|...       :.|.|:|. ..::||:    ...|.|:|...:.
  Fly   193 IPIFGL----TGFHMVLVSRGRTTN-------EQVTGKFK-GGYNPFSRGCWHNCCYTQFGPQYP 245

  Fly   292 SV 293
            |:
  Fly   246 SL 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 40/126 (32%)
Zdhhc8NP_001259382.1 zf-DHHC 94..219 CDD:279823 42/151 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.