DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001034190.1 Gene:Zdhhc15 / 317235 RGDID:1562075 Length:337 Species:Rattus norvegicus


Alignment Length:309 Identity:87/309 - (28%)
Similarity:130/309 - (42%) Gaps:79/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNY---------TV 68
            |||.       |||..              :::|:.:|     |:.|::|.|.|         ||
  Rat    10 SGGL-------RCCRR--------------VLSWVPVL-----VIVLVVLWSYYAYVFELCLVTV 48

  Fly    69 FS----TINMIIFQALAFLAFA----SHIRTMLSDPGA--------------VPRGNATKEMIEQ 111
            .|    .|.:|::.|: |:.||    ..|.|:...|..              ..|....|:|:..
  Rat    49 LSPAEKVIYLILYHAI-FVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYKNEERPEVQKQMLVD 112

  Fly   112 MGYR--------EGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVL 168
            |..:        .|.:.: |.:|..|||:|.||||||..|:.||||||||||||:|.:|.|:|:.
  Rat   113 MAKKLPVYTRTGNGAVRF-CDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQ 176

  Fly   169 FTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQL 233
            |..|..   ::.|::..|.|:..:|. ||...|  ...:.|.:|||.|...||.:..:|:.....
  Rat   177 FLAYSV---LYCLYIATTVFSYFIKY-WRGELP--SVRSKFHVLFLLFVACMFFVSLVILFGYHC 235

  Fly   234 TAILNDQTGIEQL------KKEEARWAKKSRLKSIQSVFGRFSLAWFSP 276
            ..:..::|.:|..      ...|........:|:||.|||.....|..|
  Rat   236 WLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLIP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 48/132 (36%)
Zdhhc15NP_001034190.1 zf-DHHC <125..308 CDD:303066 58/167 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..337
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.