DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001034422.1 Gene:Zdhhc25 / 300323 RGDID:1598341 Length:279 Species:Rattus norvegicus


Alignment Length:275 Identity:113/275 - (41%)
Similarity:158/275 - (57%) Gaps:21/275 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GGSGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMI 75
            |.|....|::...:....:.|.:.|..||:|.:.||.|:|...:|::|.:|:|||..::...|.:
  Rat     9 GMSESSTGLETPLQTPNQRCWFILDPIGILCAMATWALVLSGGWVLVRDLLIPSNNMLYIVANGM 73

  Fly    76 IFQALAFLAFASHIRTMLSDPGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVC 140
            ||..||.||..||:||||:|||:||.||  :...:.:.|        ||.|.|..|:||.||:||
  Rat    74 IFHLLASLALVSHLRTMLTDPGSVPLGN--RPGPDTVSY--------CPDCRSAIPKRAAHCAVC 128

  Fly   141 QRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFL----VLTQFAECVKNDWRTCSP 201
            :|||||.|||||||||||||:|||||:||..||.....|.|.|    ||..:|   :.:|.:.|.
  Rat   129 KRCIRKNDHHCPWVNNCVGEDNQKYFLLFIMYIGLSGTHVLLLLGIPVLCSYA---RGEWDSSSS 190

  Fly   202 YSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEEARWAKKSRLKSIQSVF 266
            .||||.|   |||....||..:.:.:||.||:..|..|:|..|.|.:.......:::..:::::.
  Rat   191 VSPPAPI---LFLLLVALMGFVLSSVMLCTQMCTIYTDKTTTELLYQNTHSPGNRAKCANLKAIC 252

  Fly   267 G-RFSLAWFSPFTEP 280
            | ..||||.|||..|
  Rat   253 GSHISLAWLSPFHSP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 65/130 (50%)
Zdhhc25NP_001034422.1 zf-DHHC 109..230 CDD:279823 64/134 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.