DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001034189.1 Gene:Zdhhc24 / 293665 RGDID:1565630 Length:284 Species:Rattus norvegicus


Alignment Length:283 Identity:66/283 - (23%)
Similarity:106/283 - (37%) Gaps:62/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 WCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMI----------IFQALAFLAF 85
            |..:...|....:......|:|..||:.|           |..|:          :.:||.....
  Rat     5 WAARGTEGAPARMPVVFTALWAAVVVLEL-----------TYVMVLGPGPPPLEPLARALQLALA 58

  Fly    86 ASHIRTMLSDPGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHH 150
            |..:..:|.:.|...|.:.:...:...|...||.:..|.:|.|..|.|:.|||.|:.||.:.|||
  Rat    59 AYQLLNLLGNMGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHH 123

  Fly   151 CPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLF-- 213
            |..:..|||.:|.:.|:....:.|.:.:|...|:....:..::       .:|...|:.|||.  
  Rat   124 CRLLGRCVGFHNYRPFLCLLLHAAGVLLHISVLLSPALSALLQ-------AHSALYTVALLLLPW 181

  Fly   214 ---------LTFEGLMFGIFTIIMLATQLTA--------ILNDQTGIEQLKKEEARWAKKSR--- 258
                     |....|.|.:.|.:..|....|        :|..||..|        ||:...   
  Rat   182 LMLLTGKVSLAQFALAFVVDTCVAGALLCGAGLLFHGMLLLRGQTTWE--------WARGQHSYD 238

  Fly   259 ---LKSIQSVFG-RFSLAWFSPF 277
               ..::|:..| |::|.||.||
  Rat   239 LGMSHNLQAALGPRWALVWFWPF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 38/145 (26%)
Zdhhc24NP_001034189.1 zf-DHHC 95..234 CDD:279823 40/153 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.