DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:256 Identity:66/256 - (25%)
Similarity:108/256 - (42%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 MTWLL-ILFAEFVVMRLILLPSNYTVFSTINMI-----IFQA----LAFLAFASHIRTMLSDPGA 98
            ::|.. .|||.|.|..|:.|...:..|....::     :|.|    |..|.|.|.:....||||.
  Rat    25 LSWFFPSLFAAFNVSLLVFLSGLFFGFPCRWLVQNGEWVFPAVTGPLFILTFFSLVSLNFSDPGI 89

  Fly    99 VPRGNATKEMIEQMGYREGQMFYK---CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGE 160
            :.||:.:::.......|..|..::   ||||...:|.|.:||..|..|:...||||.|||||:|.
  Rat    90 LHRGSVSEDPRTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGH 154

  Fly   161 NNQKYFVLFTFYI-----ASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLM 220
            .|.:.|||...::     |.:....:||:.|...           |:|....:.:|:.:...|.:
  Rat   155 RNFRLFVLLILFLCLYSGALLVTCLMFLIHTSHL-----------PFSLDKAMAILVAVPAAGFL 208

  Fly   221 FGIFTIIMLATQLTAILNDQTGIEQLKKEEARWAKKSRLKSIQSVFGR-FSLAWFSPFTEP 280
            ..:| ::||...|:           :.:.|..:..|.|.....:.|.: |:..|:.....|
  Rat   209 IPLF-LLMLIQALS-----------VSRAERSYESKCRDHEEYNPFDQGFAKNWYLTMCAP 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 36/134 (27%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 37/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.