DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and erf2

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_595766.1 Gene:erf2 / 2541058 PomBaseID:SPBC3H7.09 Length:350 Species:Schizosaccharomyces pombe


Alignment Length:289 Identity:70/289 - (24%)
Similarity:102/289 - (35%) Gaps:95/289 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CCGN-------KAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINM-------- 74
            |||.       ||               :|:.|||      |||....:.:||...:        
pombe    74 CCGRLQMSSQYKA---------------FLISLFA------LILPGVLFFIFSAFWLWHHVSPAV 117

  Fly    75 -IIFQALAFLAFASHIRTMLSDPGAVPRGNA-----------------TKEMIEQMGYREGQMFY 121
             |.|..|..||..|..:...:|||.:|| ||                 .|.::...  |...:|.
pombe   118 PITFAYLYALAVVSMFKCSTADPGILPR-NAYSLTYNPAHPWSVIPEDRKVLVGST--RSDSVFV 179

  Fly   122 K---CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFL 183
            .   |..|...:|.||.||.:|..|:..:||||.|:|.|:|..|.:|:.:|   :.|:.:..|:|
pombe   180 NTVYCHTCHLYRPPRASHCHLCDNCVEYLDHHCIWLNTCIGRRNYRYYFIF---LLSVVLSALYL 241

  Fly   184 ---------------VLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQL 233
                           ..|.||..::..|...|           .||...|.:..|...|:...|.
pombe   242 TGLGFYTSIGSFHESTDTNFAAHLRRPWAGVS-----------FFLGIYGALGAILPGILFCYQC 295

  Fly   234 TAILNDQTGIEQLKKEEARWAKKSRLKSI 262
            ..|...|...|.|:      ||.:..:.:
pombe   296 YLISVGQNVHEYLR------AKSTETEDV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 38/144 (26%)
erf2NP_595766.1 COG5273 57..350 CDD:227598 70/289 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I1713
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.