DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_659564.3 Gene:Zdhhc2 / 246326 RGDID:628681 Length:366 Species:Rattus norvegicus


Alignment Length:315 Identity:79/315 - (25%)
Similarity:129/315 - (40%) Gaps:60/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSPGGSGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTI 72
            ::|.|.||.     ..||.....|        :.|:...||:.::.:.....:.:.|...:...:
  Rat     1 MAPSGPGGV-----RRRCRRVLYW--------IPVVFISLLLGWSYYAYAIQLCIVSMENIGEQV 52

  Fly    73 NMIIFQALAFLAFA-SHIRTMLSDP-----------------GAVPRGNATKEMIEQMG------ 113
            ..::...|.|..|. |:.:|:.:.|                 ...|||.|.:|::.:..      
  Rat    53 VCLMAYHLLFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIY 117

  Fly   114 --YREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASI 176
              ...|.:.| |.:|..|||:|.||||||.:||.||||||||||||||.:|.|:|:||..|..  
  Rat   118 TRTMSGAIRY-CDRCRLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSL-- 179

  Fly   177 SVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQT 241
             ::.||:..|.....:: .|....|.:...  |.::||.|...||.:....:.......:..:::
  Rat   180 -LYCLFIAATDLQYFIR-FWTNGLPDTQAK--FHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKS 240

  Fly   242 GIEQLKKEEARWAKKSR------LKSIQSVFGRFSLAWFSPF--------TEPSC 282
            .:|..:....|......      .|:::.|||.....|..|.        :.|:|
  Rat   241 TLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPIFSSQGDGCSFPTC 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 46/126 (37%)
Zdhhc2NP_659564.3 DHHC 19..301 CDD:418707 73/292 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..366
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000250|UniProtKB:P59267 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 334..335
NPxY-like endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.