DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:281 Identity:71/281 - (25%)
Similarity:121/281 - (43%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VKDICGIVCVIMTWL-LILFAEFVVMRLILL-------PSNYTV------FSTINMIIFQALAFL 83
            ||:...:..:.::|. ..:||.|.|..|:.|       |..:.|      |..|...:|    .|
Mouse    11 VKEPQQLPSIPLSWFPSSVFAAFNVTLLLFLSGLFFGFPCRWLVQNGEWAFPAITGPLF----IL 71

  Fly    84 AFASHIRTMLSDPGAVPRGNATKEMIEQMGYREGQMFYK---CPKCCSIKPERAHHCSVCQRCIR 145
            .|.|.:....||||.:.||:..::.:.....|..|..::   ||||...:|.|.:||..|..|:.
Mouse    72 TFFSLVSLNFSDPGILHRGSTKEDPMTVHVVRVNQRAFRLEWCPKCLFHRPPRTYHCPWCNICVE 136

  Fly   146 KMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCS-PYSPPATIF 209
            ..||||.|||||:|..|   |.||...:.|:.:::..|::|    |:...:||.. |:|....:.
Mouse   137 DFDHHCKWVNNCIGHRN---FRLFMLLVLSLCLYSGALLVT----CLTFLFRTRHLPFSLDKGMA 194

  Fly   210 LLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEEARWAKKSRLKSIQSVFGR-----F 269
            :|:.:...|.:..:|.::::...            .:.:.|:.:..|.|.....:.|.:     :
Mouse   195 ILVAVPAAGFLIPLFLLLLIQAL------------SVSRAESSYESKCRYHPEYNPFDQGFAKNW 247

  Fly   270 SLAWFSP-----FTEPSCRTR 285
            .||.|:|     .:|..|..|
Mouse   248 YLAMFAPLGPNYMSEVVCLQR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 35/130 (27%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 28/78 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.