DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and dhhc-12

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_492753.2 Gene:dhhc-12 / 186602 WormBaseID:WBGene00010323 Length:310 Species:Caenorhabditis elegans


Alignment Length:266 Identity:63/266 - (23%)
Similarity:97/266 - (36%) Gaps:77/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VKDICGIVCVI------MTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRT 91
            |..:|.:..|:      :.|.......|.|.|.:||           :.|:.::.|..:.:...|
 Worm    47 VGTLCNVTYVVIFKMIPVEWNECQNMSFFVFRFVLL-----------IYIYYSVVFHYYKARTLT 100

  Fly    92 MLSDPGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNN 156
            .:.:||.                 ....|  |.||.:.|.....||..|.:||.:||||||.:..
 Worm   101 PVVNPGT-----------------PSDSF--CIKCNNWKGPSTSHCKACDKCIYRMDHHCPHIGQ 146

  Fly   157 CVGENNQKYFVLFTFYIASISVHTLFLVLTQF----------AECVKND--WRTCSPYSPPATIF 209
            |||.:||.:|.||.||: .|:....||:.|.|          ...:.:|  |   .||......:
 Worm   147 CVGAHNQSHFFLFLFYL-QIATGLFFLMATTFWMKWIETRKELTAIPDDQCW---PPYCFNRYYY 207

  Fly   210 LL----------------LFLTFEGLMFGI----FTIIMLATQLTAILNDQTGIEQLK-----KE 249
            |:                ||:|...:|:|.    ..||.....:...:..::..|..|     ..
 Worm   208 LITRSQGTEDTMVKFAFFLFVTLHWIMWGFVGVYVGIISFGLTMAMKMFQKSDAESRKPFTWFTI 272

  Fly   250 EARWAK 255
            :|||.|
 Worm   273 KARWRK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 44/163 (27%)
dhhc-12NP_492753.2 zf-DHHC 39..>172 CDD:303066 41/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.