DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and dhhc-14

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001024514.2 Gene:dhhc-14 / 181109 WormBaseID:WBGene00044071 Length:565 Species:Caenorhabditis elegans


Alignment Length:266 Identity:60/266 - (22%)
Similarity:95/266 - (35%) Gaps:80/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 MTWLLILFAEFVV------------MRLI----------LLPSNYTVFSTINMII---------- 76
            ||:||..:...::            |.||          |||...|:...|.|::          
 Worm   282 MTYLLFKYLPLIIATFSTLISCIFLMVLIRFDYHDPTYKLLPYGVTIAEAILMVLSWSAYAHWYV 346

  Fly    77 -----------FQALAFLAFASHIRTMLSDPGAVPRGNATKEMI---EQMGYREGQMFYKCPKCC 127
                       ..||||..|  .|.|:  |||.|.......::.   .:.|.:..|.:  |..|.
 Worm   347 PWWAQMLFVLSVLALAFTLF--RIGTL--DPGVVRAAKNCHQLFVNEAEAGIQHQQKY--CFTCF 405

  Fly   128 SIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVLF--------TFYIASISVHTLFLV 184
            ..|.:...||:||..|:...||||||:|:||...|.:.|::|        ..|..:.|.:.|..:
 Worm   406 IRKMDHTKHCAVCGFCVNNFDHHCPWLNSCVTRRNMREFIMFVISVSVSSAIYCMATSHYALLQI 470

  Fly   185 ----LTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQ 245
                |.:|.|               ...||::.:.... |..:...::...|:..|....|..::
 Worm   471 EDHGLEEFLE---------------TDAFLMITIILSA-MHALMLAVLFCVQMNQISQGVTTNDR 519

  Fly   246 LKKEEA 251
            :|...|
 Worm   520 IKARRA 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 33/138 (24%)
dhhc-14NP_001024514.2 ANK 19..143 CDD:238125
Ank_2 30..120 CDD:289560
ANK repeat 55..87 CDD:293786
ANK repeat 89..120 CDD:293786
Ank_2 94..222 CDD:289560
ANK 117..244 CDD:238125
ANK repeat 190..222 CDD:293786
PulO <261..>367 CDD:224900 18/86 (21%)
zf-DHHC 394..521 CDD:279823 33/144 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.