DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and dhhc-8

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001370072.1 Gene:dhhc-8 / 176731 WormBaseID:WBGene00012718 Length:471 Species:Caenorhabditis elegans


Alignment Length:299 Identity:77/299 - (25%)
Similarity:121/299 - (40%) Gaps:85/299 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 KDICGIVCVIMTWLLIL-----FAEFVVMRLILLPSNYTVFSTINMII--FQALAFLAFASH-IR 90
            |.|..::...:.|.||:     |..|:.      |..:..:.|..:|:  ...:.||..:|: :.
 Worm     3 KRISALLPAAIAWALIIGCSVSFFWFIA------PQIWNQWHTPGLILIAIDVVLFLMVSSNLLM 61

  Fly    91 TMLSDPGAVPRGNATKEMIEQMGYREGQMFYK-------------CPKCCSIKPERAHHCSVCQR 142
            .||.||...|....::|..:....|  ...||             |..|...:|.|:.|||||.|
 Worm    62 AMLLDPAVHPYAIGSEEPTQVDDLR--APLYKNVDINGITVRMKWCVTCKFYRPPRSSHCSVCNR 124

  Fly   143 CIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCSP------ 201
            ||...|||||||:||||:.|.:||.   |::.|:|:|.:::    |..|....|.....      
 Worm   125 CIETFDHHCPWVHNCVGKRNYRYFF---FFLCSLSIHMMYV----FFLCFAYVWSGSDTNARDHI 182

  Fly   202 YSPP---ATIFLLL--FLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEEARWAKKSRLKS 261
            .|||   |.:.|.|  .|....:...:|.::::|...|.  |:|                     
 Worm   183 LSPPYLCAIVLLALCAVLCVPVIGLTVFHLVLVARGRTT--NEQ--------------------- 224

  Fly   262 IQSVFGRFSLAWFSPFT--------EPSCRTR---FNSH 289
               |.|:|: :.::|||        :..|.::   |.||
 Worm   225 ---VTGKFT-SGYNPFTIGCWGNCKKTLCHSQLPTFKSH 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 46/150 (31%)
dhhc-8NP_001370072.1 DHHC 98..228 CDD:396215 46/162 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.