DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and ZDHHC19

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001034706.1 Gene:ZDHHC19 / 131540 HGNCID:20713 Length:309 Species:Homo sapiens


Alignment Length:219 Identity:58/219 - (26%)
Similarity:96/219 - (43%) Gaps:44/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VVMRLILLPSNYTVFSTINMIIFQALAF------------------------LAFASHIRTMLSD 95
            :|.|...|||.:..|:.:.::.|..|.|                        |.|.|.:....||
Human    19 LVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWAFPVITGSLFVLTFFSLVSLNFSD 83

  Fly    96 PGAVPRGNATKE--MIEQMGYREGQMFYK-CPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNC 157
            ||.:.:|:|.:.  .:..:....|....: |||||..:|.|.:||..|..|:...||||.|||||
Human    84 PGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFHRPPRTYHCPWCNICVEDFDHHCKWVNNC 148

  Fly   158 VGENNQKYFVLFTFYI-----ASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFE 217
            :|..|.::|:|....:     |.:....:|||.|           |..|:|....|.:::.::..
Human   149 IGHRNFRFFMLLVLSLCLYSGAMLVTCLIFLVRT-----------THLPFSTDKAIAIVVAVSAA 202

  Fly   218 GLMFGIFTIIMLATQLTAILNDQT 241
            ||:..: ::::|...|:....|:|
Human   203 GLLVPL-SLLLLIQALSVSSADRT 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 39/126 (31%)
ZDHHC19NP_001034706.1 DHHC 109..>181 CDD:366691 27/71 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..309
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.