DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_011245807.1 Gene:Zdhhc15 / 108672 MGIID:1915336 Length:355 Species:Mus musculus


Alignment Length:309 Identity:87/309 - (28%)
Similarity:130/309 - (42%) Gaps:79/309 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SGGFGGVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNY---------TV 68
            |||.       |||..              :::|:.:|     |:.|::|.|.|         ||
Mouse    10 SGGL-------RCCRR--------------VLSWVPVL-----VIVLVVLWSYYAYVFELCLVTV 48

  Fly    69 FS----TINMIIFQALAFLAFA----SHIRTMLSDPGA--------------VPRGNATKEMIEQ 111
            .|    .|.:|::.|: |:.||    ..|.|:...|..              ..|....|:|:..
Mouse    49 LSPAEKVIYLILYHAI-FVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYKNEERPEVQKQMLVD 112

  Fly   112 MGYR--------EGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQKYFVL 168
            |..:        .|.:.: |.:|..|||:|.||||||..|:.||||||||||||:|.:|.|:|:.
Mouse   113 MAKKLPVYTRTGSGAVRF-CDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQ 176

  Fly   169 FTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQL 233
            |..|..   ::.|::..|.|:..:|. ||...|  ...:.|.:|||.|...||.:..:|:.....
Mouse   177 FLAYSV---LYCLYIATTVFSYFIKY-WRGELP--SVRSKFHVLFLLFVACMFFVSLVILFGYHC 235

  Fly   234 TAILNDQTGIEQL------KKEEARWAKKSRLKSIQSVFGRFSLAWFSP 276
            ..:..::|.:|..      ...|........:|:||.|||.....|..|
Mouse   236 WLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLIP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 48/132 (36%)
Zdhhc15XP_011245807.1 DHHC <126..308 CDD:388695 58/166 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.