DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_598728.1 Gene:Zdhhc7 / 102193 MGIID:2142662 Length:308 Species:Mus musculus


Alignment Length:272 Identity:147/272 - (54%)
Similarity:194/272 - (71%) Gaps:6/272 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 NKAWCVKDICGIVCVIMTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTM 92
            ::.|.::|.||:||.:|||||:::|:|||..::||||....:|.:|.::|..||.||.:||:|||
Mouse    37 DRVWFIRDGCGMVCAVMTWLLVVYADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTM 101

  Fly    93 LSDPGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNC 157
            |:||||||:||||||.:|.:..:.|::.|||||||.||||||||||:|:||||||||||||||||
Mouse   102 LTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNC 166

  Fly   158 VGENNQKYFVLFTFYIASISVHTLFLVLTQFAECVKNDWRTCSPYSPPATIFLLLFLTFEGLMFG 222
            |||.||::|||||.|||..|||.|.|...||..||:..|..||.:|||.|:.||:||..|||:|.
Mouse   167 VGEKNQRFFVLFTMYIALSSVHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFF 231

  Fly   223 IFTIIMLATQLTAILNDQTGIEQLKKEEARWAKKSRLKSIQSVF-GRFSLAWFSPFT-----EPS 281
            .||.:|..||:.:|.||:|.||:||.|:..|.::.|.:.::||| |..||.|.:||.     ...
Mouse   232 TFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRLRRLQ 296

  Fly   282 CRTRFNSHFYSV 293
            .|||.....:||
Mouse   297 MRTRKGGPEFSV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 83/126 (66%)
Zdhhc7NP_598728.1 DHHC 131..258 CDD:366691 83/126 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 201 1.000 Domainoid score I3009
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 347 1.000 Inparanoid score I2288
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49015
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 1 1.000 - - FOG0001671
OrthoInspector 1 1.000 - - otm43062
orthoMCL 1 0.900 - - OOG6_104274
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2063
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.