DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc12a

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:XP_002663098.1 Gene:zdhhc12a / 100332332 ZFINID:ZDB-GENE-081104-40 Length:270 Species:Danio rerio


Alignment Length:217 Identity:61/217 - (28%)
Similarity:98/217 - (45%) Gaps:62/217 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VIMTWL--LILFAEFVVMRL------ILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGA 98
            ||:||:  ||||.....:|.      :|.|           ::|.::..|:...:....|.|||.
Zfish    17 VILTWIITLILFLHNTDLRRCQERGDLLQP-----------LVFSSVLLLSVLLYFTVSLMDPGF 70

  Fly    99 VPRGNATK-------EMIEQMGYREGQMF--YKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWV 154
            |...:.|:       |.:|.|..:|....  .:|..|..::|.||.||..|:||:|:.||||||:
Zfish    71 VLSDSQTETASGDGDEELEAMIPQEQNSIKQRRCGYCFLLQPMRARHCKWCKRCVRRFDHHCPWI 135

  Fly   155 NNCVGENNQKYFVLFTFYIASISVHTLFLVLTQF-AECVKNDWRTCSPY----SPPA-------T 207
            :|||||.|.::|:|:              :..|| |.|    |...|.:    |.|:       .
Zfish   136 DNCVGELNHRWFLLY--------------LCVQFTAVC----WGLQSAWSGFISAPSWQQWFTQN 182

  Fly   208 IFLLLFLTFEGLMFGIFTIIML 229
            :|||:...    :..:|::::|
Zfish   183 VFLLVAFA----VTAVFSVVLL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 38/120 (32%)
zdhhc12aXP_002663098.1 DHHC 104..221 CDD:396215 38/119 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.