DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and pigv

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001186989.1 Gene:pigv / 100148642 ZFINID:ZDB-GENE-121116-1 Length:523 Species:Danio rerio


Alignment Length:272 Identity:51/272 - (18%)
Similarity:79/272 - (29%) Gaps:106/272 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GVDQHNRCCGNKAWCVKDICGIVCVIMTWLLILFA--EFVVMRLILLPSNYTVFSTINMIIFQAL 80
            ||..||                    ..|.|:.||  ..|...|:.||..          :||..
Zfish   250 GVQYHN--------------------YIWELVRFAFTGAVYAALVALPFG----------LFQFY 284

  Fly    81 AFLAFASHIRTMLSDPGAVPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIR 145
            .|..|..            |..|.....:..:...:|   |:.....|.||:..|          
Zfish   285 GFQTFCH------------PTSNQIPPALVNLAQHKG---YRVADAASPKPKWCH---------- 324

  Fly   146 KMDHHCPWVNNCVGE-----NNQKYF-------VLFTFYIASISVHTLFLVLTQ---FAECV--- 192
               ...|.:.:.:.:     ...:||       .:....:|::....||:.:|.   |  |:   
Zfish   325 ---WQIPLLYSYIQDVYWDVGFLRYFQWKQIPNFILALPVATLGFKALFIYITDNPVF--CMYLG 384

  Fly   193 -------KNDWRTCSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGI------- 243
                   |..:..|:|     .:|:.:......|:||||  .|....||..|...:.:       
Zfish   385 LGEKGNSKKIYGFCNP-----RVFVYIVHNTVLLLFGIF--CMHVQVLTRFLASSSPVLYWVSGH 442

  Fly   244 -----EQLKKEE 250
                 |.|.|||
Zfish   443 LLFKYEPLLKEE 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 28/163 (17%)
pigvNP_001186989.1 PMT_2 23..523 CDD:304453 51/272 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.