DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8314 and zdhhc6

DIOPT Version :9

Sequence 1:NP_611070.1 Gene:CG8314 / 36757 FlyBaseID:FBgn0034057 Length:293 Species:Drosophila melanogaster
Sequence 2:NP_001090863.1 Gene:zdhhc6 / 100038280 XenbaseID:XB-GENE-979137 Length:410 Species:Xenopus tropicalis


Alignment Length:271 Identity:72/271 - (26%)
Similarity:106/271 - (39%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ICGIVCVI--MTWLLILFAEFVVMRLILLPSNYTVFSTINMIIFQALAFLAFASHIRTMLSDPGA 98
            ||.|:.::  :.|...|......:..:.| .|:||     ||::         ::...|...||.
 Frog    31 ICSIMAILDSILWYWPLDTPGGSLNFLTL-VNWTV-----MILY---------NYFNAMFIGPGF 80

  Fly    99 VPRGNATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQRCIRKMDHHCPWVNNCVGENNQ 163
            ||.| ...|..:...|.:     .|..|...|..|:|||..|.||:.||||||||:|||.|..|.
 Frog    81 VPLG-WKPERTQDCAYLQ-----YCKVCEGYKAPRSHHCRKCNRCVMKMDHHCPWINNCCGHRNH 139

  Fly   164 KYFVLFTFYIASISVHTLFLVL----TQFAECVKNDW-----------RTCSPYSP------PAT 207
            ..|.||........:|..::.:    ||....:...|           |..:|..|      ..|
 Frog   140 SSFTLFLILAPLGCIHAAYIFIMTMYTQLYNRISFGWNSVKIDMSASRRDPAPIVPFGISAFAVT 204

  Fly   208 IFLLLFLTFEGLMFG--IFTIIMLATQLTAILNDQTGIEQLKKEEAR---------------WAK 255
            :|.|      ||..|  |...::...|:..||.::|.||...:|:|:               :..
 Frog   205 LFAL------GLALGTTIAVGMLFFIQMKVILRNKTSIESWIEEKAKDRIQYYQTDETFIFPYDL 263

  Fly   256 KSRLKSIQSVF 266
            .||.|:.:.||
 Frog   264 GSRWKNFRQVF 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8314NP_611070.1 DHHC 122..249 CDD:396215 46/149 (31%)
zdhhc6NP_001090863.1 zf-DHHC 95..239 CDD:307600 47/154 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.