DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8366 and AT1G67660

DIOPT Version :9

Sequence 1:NP_611068.3 Gene:CG8366 / 36754 FlyBaseID:FBgn0034054 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_176934.2 Gene:AT1G67660 / 843091 AraportID:AT1G67660 Length:355 Species:Arabidopsis thaliana


Alignment Length:227 Identity:51/227 - (22%)
Similarity:85/227 - (37%) Gaps:60/227 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 IIESLYEATRSKYKSRLWVEVQYMRI----------------RCSMMHMIISRKTSDDDDQIFNM 296
            |:.||...:....||..|..::..::                |..:.|    .|..|.|.::.  
plant   104 IVSSLLSPSDIPQKSEEWFALRKDKLTTSTFSTALGFWKGNRRAELWH----EKVYDSDARVV-- 162

  Fly   297 MFCRGRDKNNEDRVQQKEHKRFILKQTEKLEN------KNYLEC-----GLILHEN--FPFLCAA 348
                            :|..||.:....::|:      |..:.|     |..:|.|  |.:|.|:
plant   163 ----------------EESARFAMNWGVQMESSAIERYKRIMGCEVGTMGFAIHSNEEFHWLGAS 211

  Fly   349 PDGITDDH-IVEIKSPKTDEDFEKYLEARESIAPKYMAQIQIQMFAANVKKA-LYCVLSPTFESN 411
            ||||.|.. |:|:|.|......|..|..:: :...||.|:|.||...:.:.. |||     :..|
plant   212 PDGILDCFGILEVKCPYNKGKTETVLPWKK-VPYYYMPQLQGQMEIMDREWVNLYC-----WTRN 270

  Fly   412 GALHYVWVQADPEFVSSLLSMAEDFWRDVVFP 443
            |:..: .|..|..:...:..:..:||.:.|.|
plant   271 GSTVF-RVMRDRSYWRIIHDVLREFWWESVIP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8366NP_611068.3 YqaJ 56..247 CDD:286647
YqaJ <328..406 CDD:298855 28/92 (30%)
AT1G67660NP_176934.2 YqaJ 120..260 CDD:286647 35/162 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1023757at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.