DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8366 and LOC101732574

DIOPT Version :9

Sequence 1:	NP_611068.3	Gene:	CG8366 / 36754	FlyBaseID:	FBgn0034054	Length:	455	Species:	Drosophila melanogaster
Sequence 2:	XP_004914452.2	Gene:	LOC101732574 / 101732574	-ID:	-	Length:	743	Species:	Xenopus tropicalis

Alignment Length:	64	Identity:	18/64 - (28%)
Similarity:	28/64 - (43%)	Gaps:	5/64 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   383 YMAQIQIQMFAANVKKALYCVLSPTFESNGALHYVWVQADPEFVSSLLSMAEDFWRDVVFPRLL 446
            |..|:|   |..::...:|..|........|:..||:  |.:|:.......|.|:.|:|.|.||
Frog   669 YYTQLQ---FLMDITDNVYAELLVHTNKETAIVPVWI--DFDFLEEAEKKLERFYTDIVLPYLL 727

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8366	NP_611068.3	YqaJ	56..247	CDD:286647
CG8366	NP_611068.3	YqaJ	<328..406	CDD:298855	6/22 (27%)
LOC101732574	XP_004914452.2	PDDEXK_nuclease-like	529..718	CDD:424071	12/53 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1023757at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.010