powered by:
Protein Alignment CG8366 and LOC101732574
DIOPT Version :9
Sequence 1: | NP_611068.3 |
Gene: | CG8366 / 36754 |
FlyBaseID: | FBgn0034054 |
Length: | 455 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004914452.2 |
Gene: | LOC101732574 / 101732574 |
-ID: | - |
Length: | 743 |
Species: | Xenopus tropicalis |
Alignment Length: | 64 |
Identity: | 18/64 - (28%) |
Similarity: | 28/64 - (43%) |
Gaps: | 5/64 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 383 YMAQIQIQMFAANVKKALYCVLSPTFESNGALHYVWVQADPEFVSSLLSMAEDFWRDVVFPRLL 446
|..|:| |..::...:|..|........|:..||: |.:|:.......|.|:.|:|.|.||
Frog 669 YYTQLQ---FLMDITDNVYAELLVHTNKETAIVPVWI--DFDFLEEAEKKLERFYTDIVLPYLL 727
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1023757at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.