DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and ZC3H11A

DIOPT Version :9

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_001306167.1 Gene:ZC3H11A / 9877 HGNCID:29093 Length:810 Species:Homo sapiens


Alignment Length:807 Identity:168/807 - (20%)
Similarity:289/807 - (35%) Gaps:214/807 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  4614 ESQKEEVKDSEAKPKKAKVLEKKSIEEEKL--EDKKEKQTESAIDEKSQKAEVSE---------I 4667
            ||.:||||.|:.           |:::.||  :.....|..|.:     |.|.||         :
Human   107 ESPEEEVKASQL-----------SVQQNKLSVQSNPSPQLRSVM-----KVESSENVPSPTHPPV 155

  Fly  4668 VSEKITDEKAQESQMEEVKDSEAKPKKAKVLEKKSIEEAKLEDKKETQTDSAIDEKSQKAEVSEI 4732
            |.....|::..:.|..|..|....|              .|:...|......:....:.|     
Human   156 VINAADDDEDDDDQFSEEGDETKTP--------------TLQPTPEVHNGLRVTSVRKPA----- 201

  Fly  4733 VSEKITDEKAQESQKEEVKDSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKS-------- 4789
                           ..:|..|......|.||:  |:.:|:::|.:||.|.:....|        
Human   202 ---------------VNIKQGECLNFGIKTLEE--IKSKKMKEKSKKQGEGSSGVSSLLLHPEPV 249

  Fly  4790 ---QKAEVSEIVSEKITDEKAQE------------SQKKEVKGSEAKPKKAKVLEKKSIEEEKLE 4839
               :|..|..:|.......|..|            .::|...|.::.|...:.|.::.       
Human   250 PGPEKENVRTVVRTVTLSTKQGEEPLVRLSLTERLGKRKFSAGGDSDPPLKRSLAQRL------- 307

  Fly  4840 DKKEKQTESAIDEKSQKAEVSEIVSEKI-----TDEKAQESQKKEVKDSEAKPKKAKVLEKKSIE 4899
            .||.:..|:.||:..:||:||:.:.|::     .|.:....:..:|.:...|..:..:||:.|.:
Human   308 GKKVEAPETNIDKTPKKAQVSKSLKERLGMSADPDNEDATDKVNKVGEIHVKTLEEILLERASQK 372

  Fly  4900 EEKLENKKEKQTESAIDEKSQKAEVSEIVSEKITDEKAQESQKKEVKDSEAKPKKAKVLEKKSIE 4964
            ..:|:.|.:.:..|..|:.:..|..|..:..|...|...|.:.::.:....|.||.....|..|:
Human   373 RGELQTKLKTEGPSKTDDSTSGARSSSTIRIKTFSEVLAEKKHRQQEAERQKSKKDTTCIKLKID 437

  Fly  4965 EEKLEDKK----------EKQTESAIDEKFQKAEVSETVSEKITDEKA------EESRKEEVKDS 5013
            .   |.||          ..|:|....:.....||.....|:|..|||      .||........
Human   438 S---EIKKTVVLPPIVASRGQSEEPAGKTKSMQEVHIKTLEEIKLEKALRVQQSSESSTSSPSQH 499

  Fly  5014 EAKP---KKAKVLEKKSIEEEK-LEDKKEKQTESAIDEKSQKAEVSETVSEKITDEKAQESQKKE 5074
            ||.|   :..::.::..::||| |::..|..::|:|..::::|. .||....||        |.:
Human   500 EATPGARRLLRITKRTGMKEEKNLQEGNEVDSQSSIRTEAKEAS-GETTGVDIT--------KIQ 555

  Fly  5075 VKDSEAKPKKAKILEKKSIEIEKLDEKKEKQTETKVATDTKSQTVEVSE---------IVLEKIS 5130
            ||..|.  .:.|.::|:        :::||...|.:..|..|...:|:|         |......
Human   556 VKRCET--MREKHMQKQ--------QEREKSVLTPLRGDVASCNTQVAEKPVLTAVPGITRHLTK 610

  Fly  5131 EEKAEESQKVELK-----DSEAKSK-KAKVLEKKSTLKEKLDENDKKQKEDGATNKSQKAEAADV 5189
            ....:.|||||::     ||....| .|:.|||:...|.|::......|...:...:.|.:|.  
Human   611 RLPTKSSQKVEVETSGIGDSLLNVKCAAQTLEKRGKAKPKVNVKPSVVKVVSSPKLAPKRKAV-- 673

  Fly  5190 VPEKISEEKVAEIKTPEPMDSKAKSKPDGLPADEKSHGAKVSESVPVKNEAEKTDQLSAKKPTVL 5254
                  |...|.|...:|:.|                 :.|.:..|.|..|.....|.::     
Human   674 ------EMHAAVIAAVKPLSS-----------------SSVLQEPPAKKAAVAVVPLVSE----- 710

  Fly  5255 DEDLVVPKRKPYLAEQTADSISL-QTYKSMDS-------------EYKDRKESRSAKRKPTVDIQ 5305
            |:.:.||:     ||...||:.| .|..|.||             ..|.|:.|.::..||.:.::
Human   711 DKSVTVPE-----AENPRDSLVLPPTQSSSDSSPPEVSGPSSSQMSMKTRRLSSASTGKPPLSVE 770

  Fly  5306 LTNRNTASGSDL-KLTCGLSGHEMNVQ 5331
                     .|. ||...:||.::..:
Human   771 ---------DDFEKLIWEISGGKLEAE 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352 6/33 (18%)
IGc2 5313..5378 CDD:197706 5/20 (25%)
IG 5412..5482 CDD:214652
IGc2 5413..5481 CDD:197706
I-set 5542..5627 CDD:254352
Ig 5556..5621 CDD:143165
Ig 5654..5721 CDD:143165
I-set 5784..5874 CDD:254352
IGc2 5797..5864 CDD:197706
I-set 5887..5970 CDD:254352
Ig 5902..5966 CDD:143165
I-set 5997..6086 CDD:254352
Ig 6026..6083 CDD:143165
I-set 6097..6187 CDD:254352
Ig 6114..6187 CDD:299845
FN3 6216..6310 CDD:238020
I-set 6321..6412 CDD:254352
Ig 6328..6412 CDD:299845
I-set 6442..6531 CDD:254352
Ig 6459..6528 CDD:143165
I-set 6541..6632 CDD:254352
IGc2 6555..6622 CDD:197706
I-set 6662..6754 CDD:254352
Ig 6679..6751 CDD:143165
I-set 6779..6868 CDD:254352
IGc2 6793..6858 CDD:197706
Ig 6938..7022 CDD:299845
I-set 6939..7028 CDD:254352
IG 7075..7140 CDD:214652
Ig 7075..7140 CDD:143165
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020
S_TKc 7620..7876 CDD:214567
STKc_MLCK 7626..7876 CDD:271005
ZC3H11ANP_001306167.1 zf-CCCH_3 1..110 CDD:373997 2/2 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..194 12/73 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 223..258 7/34 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..351 15/72 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..432 14/64 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..549 16/67 (24%)
Caprin-1_C 687..>773 CDD:372014 23/121 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..768 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.918296 Normalized mean entropy S8347
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.