DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and MYLK3

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_872299.2 Gene:MYLK3 / 91807 HGNCID:29826 Length:819 Species:Homo sapiens


Alignment Length:719 Identity:238/719 - (33%)
Similarity:349/719 - (48%) Gaps:132/719 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  7260 SSSGELCVLERDLR--GQDEECVQLLK---TPLPVVCASG---DEALFYARVFPCDAEADWYLNG 7316
            |:||    ::.|.|  |::.:...:|:   ..||.:.|||   |.|  .|.|.|          |
Human   176 STSG----VQSDAREPGEESQKADVLEGTAERLPPIRASGLGADPA--QAVVSP----------G 224

  Fly  7317 QLLAQADDSLNMTLESYPENGIRLLRMRDVTASRSGEICLQVKHPQAEFRRIPTTRTYTSLLVLP 7381
            |     .|.:....:::|                 |.:.|..| .:|:....|:....|.|.:.|
Human   225 Q-----GDGVPGPAQAFP-----------------GHLPLPTK-VEAKAPETPSENLRTGLELAP 266

  Fly  7382 AI-RGNSSSSSL-----AARSCILTRPEDCTALIGGHVRLSVRYEPFPGTKV-------IWYKAC 7433
            |. |.|..|.||     |.:....:|| |...|..|     .|..|.||.:.       ...:|.
Human   267 APGRVNVVSPSLEVAPGAGQGASSSRP-DPEPLEEG-----TRLTPGPGPQCPGPPGLPAQARAT 325

  Fly  7434 HPIVESSNVTIRTTSQQSTLYITDISADDSGKYTVEVMNDYG----VEA-AAASVAVEGPP---- 7489
            |...|        |..:.:::|.::  |..|:..:......|    .|| |||....:|||    
Human   326 HSGGE--------TPPRISIHIQEM--DTPGEMLMTGRGSLGPTLTTEAPAAAQPGKQGPPGTGR 380

  Fly  7490 --EPPSGQP-------SVSLGPDRVAVAWCGPPYDGGCMITGFIIEMQTIGDE---------NCD 7536
              :.|..:|       :..|.|.:.:.:      .||....    |.|..|.|         :.|
Human   381 CLQAPGTEPGEQTPEGARELSPLQESSS------PGGVKAE----EEQRAGAEPGTRPSLARSDD 435

  Fly  7537 EDSWQQVTRVVDSLAYTVKNLQPERQYRFR--VRAENIHGRSAPGQASELVQITNTPQRSTSSDA 7599
            .|.......:....:....|.:||:....|  ||||.:. |..||..:..|.:.::|.....   
Human   436 NDHEVGALGLQQGKSPGAGNPEPEQDCAARAPVRAEAVR-RMPPGAEAGSVVLDDSPAPPAP--- 496

  Fly  7600 SDRFGQATVSVQSGGDFKSRFEII--EELGKGRFGIVYKVQER--GQPEQLLAAKVIKCIKSQDR 7660
               |....|||:. ....:.:|:.  |.||.||||.|::..|:  |.|   ||||:||...::||
Human   497 ---FEHRVVSVKE-TSISAGYEVCQHEVLGGGRFGQVHRCTEKSTGLP---LAAKIIKVKSAKDR 554

  Fly  7661 QKVLEEISIMRALQHPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILFLRQ 7725
            :.|..||:||..|.|..|:||..:|||.....:||||:.|||||:|:..:.:.|||:|.:||.||
Human   555 EDVKNEINIMNQLSHVNLIQLYDAFESKHSCTLVMEYVDGGELFDRITDEKYHLTELDVVLFTRQ 619

  Fly  7726 VCDGVAYMHGQSVVHLDLKPENIMCHTRTSHQIKIIDFGLAQRLDTKAPVRVLFGTPEFIPPEII 7790
            :|:||.|:|...::|||||||||:|..:|.|||||||||||:|...:..::|.||||||:.||::
Human   620 ICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVV 684

  Fly  7791 SYEPIGFQSDMWSVGVICYVLLSGLSPFMGDTDVETFSNITRADYDYDDEAFDCVSQEAKDFISQ 7855
            :||.:.|.:||||||||.|:||||||||:|:||.||.:.|....:|:|.:.|:.:|:|||||:|:
Human   685 NYEFVSFPTDMWSVGVITYMLLSGLSPFLGETDAETMNFIVNCSWDFDADTFEGLSEEAKDFVSR 749

  Fly  7856 LLVHRKEDRLTAQQCLASKWLSQRP-DDSLSNNKICTD-KLKKFIIRRKWQKTGNAIRALGRMAN 7918
            |||..|..|::|.|||..:||:..| ..|.|..::.:. .|:|:|.:|||:|....:.|..|:..
Human   750 LLVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWKKHFYVVTAANRLRK 814

  Fly  7919 LSVS 7922
            ...|
Human   815 FPTS 818

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412
PTZ00121 <4215..5072 CDD:173412
I-set 5300..5388 CDD:400151
Ig strand B 5317..5321 CDD:409353
Ig strand C 5329..5333 CDD:409353
Ig strand E 5354..5358 CDD:409353
Ig strand F 5368..5373 CDD:409353
Ig_3 5399..5477 CDD:464046
Ig 5542..5627 CDD:472250
Ig strand B 5556..5560 CDD:409353
Ig strand C 5568..5572 CDD:409353
Ig strand E 5593..5597 CDD:409353
Ig strand F 5607..5612 CDD:409353
Ig 5654..5721 CDD:409353
Ig strand B 5654..5658 CDD:409353
Ig strand C 5665..5669 CDD:409353
Ig strand E 5690..5694 CDD:409353
Ig strand F 5704..5709 CDD:409353
Ig strand G 5718..5721 CDD:409353
I-set 5784..5874 CDD:400151
Ig strand B 5801..5805 CDD:409353
Ig strand C 5814..5818 CDD:409353
Ig strand E 5840..5844 CDD:409353
Ig strand F 5854..5859 CDD:409353
Ig 5902..5963 CDD:409353
Ig strand B 5902..5906 CDD:409353
Ig strand C 5915..5919 CDD:409353
Ig strand E 5941..5945 CDD:409353
Ig strand F 5955..5960 CDD:409353
Ig 5997..6086 CDD:472250
Ig strand B 6014..6018 CDD:409353
Ig strand C 6028..6032 CDD:409353
Ig strand E 6050..6056 CDD:409353
Ig strand F 6066..6071 CDD:409353
Ig strand G 6079..6082 CDD:409353
Ig 6107..6187 CDD:472250
Ig strand B 6115..6119 CDD:409353
Ig strand C 6128..6132 CDD:409353
Ig strand E 6153..6157 CDD:409353
Ig strand F 6167..6172 CDD:409353
Ig strand G 6180..6183 CDD:409353
FN3 6216..6310 CDD:238020
I-set 6321..6412 CDD:400151
Ig strand B 6339..6343 CDD:409353
Ig strand C 6352..6356 CDD:409353
Ig strand E 6375..6382 CDD:409353
Ig strand F 6392..6397 CDD:409353
Ig strand G 6405..6408 CDD:409353
I-set 6442..6531 CDD:400151
Ig strand B 6459..6463 CDD:409353
Ig strand C 6472..6476 CDD:409353
Ig strand E 6497..6501 CDD:409353
Ig strand F 6511..6516 CDD:409353
Ig strand G 6524..6527 CDD:409353
Ig 6541..6632 CDD:472250
Ig strand B 6559..6563 CDD:409353
Ig strand C 6572..6576 CDD:409353
Ig strand E 6598..6602 CDD:409353
Ig strand F 6612..6617 CDD:409353
Ig strand G 6625..6628 CDD:409353
Ig 6662..6754 CDD:472250
Ig strand B 6679..6683 CDD:409353
Ig strand C 6692..6696 CDD:409353
Ig strand E 6720..6724 CDD:409353
Ig strand F 6734..6739 CDD:409353
I-set 6779..6868 CDD:400151
Ig strand B 6796..6800 CDD:409353
Ig strand C 6809..6813 CDD:409353
Ig strand E 6834..6838 CDD:409353
Ig strand F 6848..6853 CDD:409353
I-set 6939..7028 CDD:400151
Ig strand B 6956..6960 CDD:409353
Ig strand C 6969..6973 CDD:409353
Ig strand E 6993..6998 CDD:409353
Ig strand F 7008..7013 CDD:409353
Ig strand G 7021..7024 CDD:409353
IG_like 7075..7140 CDD:214653
Ig strand C 7082..7086 CDD:409353
Ig strand E 7107..7111 CDD:409353
Ig strand F 7121..7126 CDD:409353
Ig strand G 7135..7138 CDD:409353
Ig 7173..7232 CDD:409353
Ig strand C 7184..7188 CDD:409353
Ig strand E 7210..7214 CDD:409353
Ig strand F 7224..7229 CDD:409353
IG_like 7406..7475 CDD:214653 13/75 (17%)
Ig strand B 7413..7417 CDD:409353 0/3 (0%)
Ig strand C 7426..7430 CDD:409353 0/10 (0%)
Ig strand E 7451..7455 CDD:409353 0/3 (0%)
Ig strand F 7465..7470 CDD:409353 0/4 (0%)
FN3 7489..7588 CDD:238020 25/122 (20%)
STKc_MLCK 7626..7876 CDD:271005 131/251 (52%)
MYLK3NP_872299.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..256 26/118 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..334 17/74 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..462 24/124 (19%)
STKc_MLCK3 510..770 CDD:271094 133/262 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.