DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and VRL1

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_013712.1 Gene:VRL1 / 855011 SGDID:S000004461 Length:737 Species:Saccharomyces cerevisiae


Alignment Length:958 Identity:183/958 - (19%)
Similarity:320/958 - (33%) Gaps:336/958 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1775 KMQELQSSLAVVQETNLVEAAHSMSEASQQGTFAEALCSLERCVLQVEECMAHSGVESLTDLELS 1839
            :.:.|:|.|..:|..:      :.|.:::.|....|:.:||..|...|:...::|       .::
Yeast    34 EQKHLKSHLYYLQNFS------NNSSSTKFGILGYAVSTLEAVVCYFEDFNKNTG-------NVA 85

  Fly  1840 KLKTLATPLHDVRQYCEQ----IDVQLLEN----VIDISTHGDISELKSSGHQQTVSDHIQEVAV 1896
            |..||          ||:    :|....||    |.|::|:.||...::...|..:|        
Yeast    86 KANTL----------CEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILS-------- 132

  Fly  1897 VEEEPQVEVFDIQQGVASGIKQLEACLEVTQTDANKELQQVGKIMEQLKSDLENIQIALVTDTVQ 1961
                                    .|:      .|.:...:..|:.:.::|..      |.|.::
Yeast   133 ------------------------ICI------TNHKNYILLDILSEYENDFP------VEDLLE 161

  Fly  1962 QETVLAQAQIARTMFRLKECLVHTYESGLVDSLENVESAFEDILLSLPILESQLAEEMFAKIEKA 2026
            .||:....           .|:.:.::|      |:|:|  .:|:.: :|.:...||:.:.|.|.
Yeast   162 DETIDGST-----------LLIESIKAG------NLEAA--KVLIKI-MLFNCTEEELVSYINKT 206

  Fly  2027 --FANFVAYCERPEAVDYQKLKTLKQPIENLVGSIGAVAAQPTVDVDKSSSVVVQLQTSLMAAFR 2089
              :|..||:....|.              :::.|||..     :|..:.:|   ..||.|.:.||
Yeast   207 DKYARTVAHYLTHEM--------------DILKSIGNY-----IDWKRKNS---SGQTPLFSIFR 249

  Fly  2090 CIN--DVSEQISN--EVLGGLLKTQSSLVAVFDFIEGNDN-----------TIRVIELLQEMD-- 2137
            ..:  :..|.:..  ::.....:..:||   ||:::..||           .|.::..|.::|  
Yeast   250 SYDQPNYEEMVKTAFDIANTWYRKHNSL---FDYLDHTDNKGNSLLHVLKTNIPILLQLTKLDIN 311

  Fly  2138 ----------SITAELKALSEIHVEPTVPIDIGIIIENVSSGKAFLTEIEEGLRVNNPTCILLLD 2192
                      .:..:.|.||.|   ..:..|..:|:|.|.:...|             ||.    
Yeast   312 EENYKGLTPLMVYVKYKRLSNI---DAITKDRRLILEKVQNSTFF-------------TCF---- 356

  Fly  2193 ENTDDIAQLEATLVQIEKEILSQPQLSQITTKQFALIDALQLQISNLQEKLNKLNVFLSELQSQS 2257
                |.|:        :..:||:.....:....|.||....|:..||....|        :.|.|
Yeast   357 ----DYAK--------DHSVLSKIGERGVKDSLFGLIYFHSLRYHNLNATTN--------ITSVS 401

  Fly  2258 DVSSPESALDTDIDLKEGSGSQEDI---EPEAKRPKMLESEQQLDSYKQTETQEEVPKETDDETK 2319
            :...|.:.  |.|::|...|....|   .|....|        |::|                  
Yeast   402 NAEKPFAT--TVINMKTIQGLLRSILKDNPFTFLP--------LNTY------------------ 438

  Fly  2320 KDIEVESKLENQNELVAKKDEQKADKVSEQEKLQESKQQTEVDDTQKSTEVVSQKASPENI---- 2380
              |:..|.| |:::|..   ..|.|..|...:|           |.....::..|..|||:    
Yeast   439 --IDEISHL-NRSDLTI---IGKTDVTSLLHQL-----------TNCFNVLLFLKKIPENLFTDE 486

  Fly  2381 ------LEALSEKLSQSPN-----NATQNDEIKTIMTECQDILD-NIDNIEKVSKSIFKLREHIV 2433
                  :...:.|.:|.|:     ...:.:||..|    |..|. |.|.|.....|:..||:.::
Yeast   487 ASILYWMRINTSKRNQKPSGKENPKTMEPEEINMI----QSFLRFNFDEISSFKASLNILRKVLI 547

  Fly  2434 HTFDGKPPEEQTEK---ELVEKLIESLFESCPEATEHVIQTYIKEIKTNIILTKAAIQLIDDSNL 2495
            .........|...|   |:..|||.|      ||:     :..|.|.||             .|:
Yeast   548 FINLKSDDFEDAYKGLNEMGRKLINS------EAS-----SAFKGIITN-------------HNM 588

  Fly  2496 FTKPSL--LVPKLVNLE----KLSELTQTVKLIDKSSK------EMIGLQQNLMDIFIILDDLLD 2548
            |::.||  |:..:..||    :||...|.: |.:|...      |.:.|.::....|        
Yeast   589 FSELSLAALLENVRFLEQCTIQLSSFVQII-LFEKIPNWWKHYGEFLALHKSYRKAF-------- 644

  Fly  2549 ERTEKINPKIENIKKILLSEYDYIEKKEGQLNTAVVNGKIKLITEKILDICEEFKQIIESQNQNK 2613
              ...:.||..:..........:||.|..|             :|:.|.:            |.|
Yeast   645 --PNMVKPKSASDTSSRAPLGGFIETKREQ-------------SEQRLAV------------QIK 682

  Fly  2614 DAAGDIKKSETEDVVDHSIEKKIEEPKRSEKKDLDKEFLEEKELKASA 2661
            .::..:|:..:|..|.|  |:..||  .|...:..|..|:::.|.|.|
Yeast   683 ASSKMLKELGSEIFVAH--ERLAEE--LSNYMEFRKACLDQRSLVAFA 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474 115/577 (20%)
PTZ00121 <2600..3256 CDD:173412 15/62 (24%)
PTZ00121 <3635..4609 CDD:173412
PTZ00121 <4215..5072 CDD:173412
I-set 5300..5388 CDD:400151
Ig strand B 5317..5321 CDD:409353
Ig strand C 5329..5333 CDD:409353
Ig strand E 5354..5358 CDD:409353
Ig strand F 5368..5373 CDD:409353
Ig_3 5399..5477 CDD:464046
Ig 5542..5627 CDD:472250
Ig strand B 5556..5560 CDD:409353
Ig strand C 5568..5572 CDD:409353
Ig strand E 5593..5597 CDD:409353
Ig strand F 5607..5612 CDD:409353
Ig 5654..5721 CDD:409353
Ig strand B 5654..5658 CDD:409353
Ig strand C 5665..5669 CDD:409353
Ig strand E 5690..5694 CDD:409353
Ig strand F 5704..5709 CDD:409353
Ig strand G 5718..5721 CDD:409353
I-set 5784..5874 CDD:400151
Ig strand B 5801..5805 CDD:409353
Ig strand C 5814..5818 CDD:409353
Ig strand E 5840..5844 CDD:409353
Ig strand F 5854..5859 CDD:409353
Ig 5902..5963 CDD:409353
Ig strand B 5902..5906 CDD:409353
Ig strand C 5915..5919 CDD:409353
Ig strand E 5941..5945 CDD:409353
Ig strand F 5955..5960 CDD:409353
Ig 5997..6086 CDD:472250
Ig strand B 6014..6018 CDD:409353
Ig strand C 6028..6032 CDD:409353
Ig strand E 6050..6056 CDD:409353
Ig strand F 6066..6071 CDD:409353
Ig strand G 6079..6082 CDD:409353
Ig 6107..6187 CDD:472250
Ig strand B 6115..6119 CDD:409353
Ig strand C 6128..6132 CDD:409353
Ig strand E 6153..6157 CDD:409353
Ig strand F 6167..6172 CDD:409353
Ig strand G 6180..6183 CDD:409353
FN3 6216..6310 CDD:238020
I-set 6321..6412 CDD:400151
Ig strand B 6339..6343 CDD:409353
Ig strand C 6352..6356 CDD:409353
Ig strand E 6375..6382 CDD:409353
Ig strand F 6392..6397 CDD:409353
Ig strand G 6405..6408 CDD:409353
I-set 6442..6531 CDD:400151
Ig strand B 6459..6463 CDD:409353
Ig strand C 6472..6476 CDD:409353
Ig strand E 6497..6501 CDD:409353
Ig strand F 6511..6516 CDD:409353
Ig strand G 6524..6527 CDD:409353
Ig 6541..6632 CDD:472250
Ig strand B 6559..6563 CDD:409353
Ig strand C 6572..6576 CDD:409353
Ig strand E 6598..6602 CDD:409353
Ig strand F 6612..6617 CDD:409353
Ig strand G 6625..6628 CDD:409353
Ig 6662..6754 CDD:472250
Ig strand B 6679..6683 CDD:409353
Ig strand C 6692..6696 CDD:409353
Ig strand E 6720..6724 CDD:409353
Ig strand F 6734..6739 CDD:409353
I-set 6779..6868 CDD:400151
Ig strand B 6796..6800 CDD:409353
Ig strand C 6809..6813 CDD:409353
Ig strand E 6834..6838 CDD:409353
Ig strand F 6848..6853 CDD:409353
I-set 6939..7028 CDD:400151
Ig strand B 6956..6960 CDD:409353
Ig strand C 6969..6973 CDD:409353
Ig strand E 6993..6998 CDD:409353
Ig strand F 7008..7013 CDD:409353
Ig strand G 7021..7024 CDD:409353
IG_like 7075..7140 CDD:214653
Ig strand C 7082..7086 CDD:409353
Ig strand E 7107..7111 CDD:409353
Ig strand F 7121..7126 CDD:409353
Ig strand G 7135..7138 CDD:409353
Ig 7173..7232 CDD:409353
Ig strand C 7184..7188 CDD:409353
Ig strand E 7210..7214 CDD:409353
Ig strand F 7224..7229 CDD:409353
IG_like 7406..7475 CDD:214653
Ig strand B 7413..7417 CDD:409353
Ig strand C 7426..7430 CDD:409353
Ig strand E 7451..7455 CDD:409353
Ig strand F 7465..7470 CDD:409353
FN3 7489..7588 CDD:238020
STKc_MLCK 7626..7876 CDD:271005
VRL1NP_013712.1 VPS9 <8..79 CDD:473191 11/50 (22%)
ANKYR 83..349 CDD:440430 66/367 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.