DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and nexn

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:XP_073765877.1 Gene:nexn / 573301 ZFINID:ZDB-GENE-041114-92 Length:935 Species:Danio rerio


Alignment Length:1119 Identity:242/1119 - (21%)
Similarity:454/1119 - (40%) Gaps:324/1119 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  4323 ETQTDSAIDEKSQKAEVSEIVSEKITDEKAQESQKEEVKDSEAKPKKAKVL----EKKSIEEEKL 4383
            :..||:.::......:::::.||...:|   |:.|||..|....|::.::.    |.|..|..:.
Zfish     9 DVSTDTHMNNTESMNDIADVDSENTVNE---ENHKEETHDMCCAPEEVEMNSAADEPKETELPEK 70

  Fly  4384 ENKKEKQTESAIDEKSQKAEVSEIVSEKITDEKAQESQKKEVKG-SEAKPKKAKVLE-KKSIEEE 4446
            |..|::...:...|:.||.: .|..|:...:|||.||...::.. |:...|:.|:|: .|.::..
Zfish    71 EKPKQETGRARKRERVQKTK-EEDTSQLENEEKADESHDIDITNMSDVALKQEKLLKTSKPVQRS 134

  Fly  4447 KL-----EDKKEK--QTESAIDEKSQKAEVSEIVSEKITDEKAQESQKEE----VKDSEAKPKKA 4500
            .:     ||.|.|  ..:.|.:|::||              ::||.||:.    ||:.|...:|.
Zfish   135 YIPKLGKEDVKNKFEAMQKAREERNQK--------------RSQEEQKKRREQYVKEREYGRRKQ 185

  Fly  4501 KVLE--KKSIEEAKLEDKKETQTDSAIDEKSQKAEVSEIVSEKITDEKAQESQKEEVKDSEAKPK 4563
            .:.|  ..|.||   |:.|.|:.     |||...:::..|..|..:.:.|..::|..:..|.:.|
Zfish   186 MIKELLASSDEE---EEVKPTKI-----EKSYVPKITGSVKGKFAEMEKQRQEEERKRTDEERKK 242

  Fly  4564 KA--KVLEKKSIEEAKLEDKKETQTDSA-----IDEKSQKAEVSEIVSEKITDEKAQESQKEEVK 4621
            :|  :.:||..|:: :|..|.|.:.|.:     :..|||| :...|   ||..|..::|::||: 
Zfish   243 RAAQEAIEKAKIQK-ELAKKAEEEGDDSLLVRVVPAKSQK-QPGRI---KINFEDMEKSREEEL- 301

  Fly  4622 DSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEVSEIVSEKITDEKAQESQMEEVK 4686
                         ||..||||::         ..||..:...           |..:.|.:|::.
Zfish   302 -------------KKRTEEEKMK---------RYDENRRSVR-----------ESKRRSVVEQLD 333

  Fly  4687 DSEAKPKKAKVLEKKSIEEAKLEDKKETQTDSAIDEKSQKAEVSEIVSEKIT-DEKAQESQKEEV 4750
            |.|.:||     ||:.:...||                           ::| :|:.:|.|:::.
Zfish   334 DGEPQPK-----EKEQVTPGKL---------------------------RLTFEEQEKERQEQQR 366

  Fly  4751 KDSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEVSEIVSEKITDEKAQESQ-KKE 4814
            |.:|.:.::....|:|:.||.||...:|                         ||..|::. :||
Zfish   367 KQAEEEARRRLEEERKAFEEAKLGMGQE-------------------------DEDTQDTHGEKE 406

  Fly  4815 VKGSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEVSEIVSEKITDEKA-QESQKK 4878
                |.:|.|.: |..:.:|.::|||:.::.      |:.:|..:.|       :.|| .|::|.
Zfish   407 ----EFRPGKLR-LSFEELERQRLEDEHKRV------EEERKRRIEE-------ERKAFAEARKS 453

  Fly  4879 EVKDSE------------AKPKKAKV----LEKKSIEEEKLENKKEKQTESAIDEKSQK-AEVSE 4926
            .|.:|:            |||.|..:    ||::..|||  :.:||::.:..::|:.:. ||..:
Zfish   454 MVINSDDDILLAMINSDGAKPGKLAISFEDLERQRQEEE--QKRKEEEAKRRLEEEKRLFAEARK 516

  Fly  4927 IVSEKITDEKAQESQKKEVKDSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKFQKAEVS- 4990
            .:|..:..:.......|||.|                     ||:...:|||.......|.|:: 
Zfish   517 SMSPGVDQDNMTGCGDKEVLD---------------------EDETLVRTESQEGLHPGKLEINF 560

  Fly  4991 -ETVSEKITDEKAEESRKEEVKDSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEV 5054
             |.:..|   |:.|..||:|.:           .:|..:|:::.|..:::..|..|:|.|   ||
Zfish   561 EEMLKMK---EETERKRKQEAR-----------RQKMEMEKKEFEQLRQEMGEEEINESS---EV 608

  Fly  5055 SETVSEKITDEKAQESQKKEVKDSEAKPKKAKILEKKSIEIEKLDEKKEKQTETKVATDTKSQTV 5119
            .....|::|  |.:.:...:.|..::|.:|.|.|.::.|: :|::|::.::.|            
Zfish   609 VSAEYEELT--KLKRTGSIQAKSLKSKFEKIKQLTEEEIQ-KKIEEERARRKE------------ 658

  Fly  5120 EVSEIVLEKISEEKAEESQKVELKDSEAKSKKAKVLEKKSTLKEKLDENDKKQKEDGATNKSQKA 5184
                 :.|:|.|.:||..|:.|.:|..:.:|...|     ..::|:|...:.::...|..:.|| 
Zfish   659 -----IDEQIKEREAERCQEDEDEDKTSPAKAEDV-----PFRQKVDMRARFEQMAKAREEEQK- 712

  Fly  5185 EAADVVPEKISEEKVAEIK-TPEPMDSKAKSKPDGLPADEKSHGAKVSESVPVKNEAEKTDQLSA 5248
                   .||.|:|:..:: ..:.:|:..:.|.|   .:|:..|:.::.|...::|         
Zfish   713 -------RKIEEQKLQRMQFEQQEIDAALQKKKD---EEEEEEGSIINGSAAYEDE--------- 758

  Fly  5249 KKPTVLDEDLVVPKRKPYLAEQTADSISLQTYKSMDSEYKDRKESRSAK---RKPTVDIQLTNRN 5310
                   ||                                  .:||..   :||     |.|::
Zfish   759 -------ED----------------------------------HARSGAPWFKKP-----LKNQS 777

  Fly  5311 TASGSDLKLTCGLSGH-EMNVQWFKDNCPIENGAKYRRTLNDGLSCLEIKSAELGDSGIYRCIAS 5374
            ......::.|..::|. :..|.|:.:..|:.:...|:........||.:......|.|.|.|.|.
Zfish   778 VVDAEPVRFTVKITGEPKPEVTWWFEGEPLPDSEDYQYIERGETYCLYLPETFPEDEGEYMCKAV 842

  Fly  5375 NQNGEVETSCLVTI 5388
            |..|...::|::||
Zfish   843 NSRGTAASTCILTI 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412 78/311 (25%)
PTZ00121 <4215..5072 CDD:173412 181/796 (23%)
I-set 5300..5388 CDD:400151 19/88 (22%)
Ig strand B 5317..5321 CDD:409353 0/3 (0%)
Ig strand C 5329..5333 CDD:409353 1/3 (33%)
Ig strand E 5354..5358 CDD:409353 2/3 (67%)
Ig strand F 5368..5373 CDD:409353 2/4 (50%)
Ig_3 5399..5477 CDD:464046
Ig 5542..5627 CDD:472250
Ig strand B 5556..5560 CDD:409353
Ig strand C 5568..5572 CDD:409353
Ig strand E 5593..5597 CDD:409353
Ig strand F 5607..5612 CDD:409353
Ig 5654..5721 CDD:409353
Ig strand B 5654..5658 CDD:409353
Ig strand C 5665..5669 CDD:409353
Ig strand E 5690..5694 CDD:409353
Ig strand F 5704..5709 CDD:409353
Ig strand G 5718..5721 CDD:409353
I-set 5784..5874 CDD:400151
Ig strand B 5801..5805 CDD:409353
Ig strand C 5814..5818 CDD:409353
Ig strand E 5840..5844 CDD:409353
Ig strand F 5854..5859 CDD:409353
Ig 5902..5963 CDD:409353
Ig strand B 5902..5906 CDD:409353
Ig strand C 5915..5919 CDD:409353
Ig strand E 5941..5945 CDD:409353
Ig strand F 5955..5960 CDD:409353
Ig 5997..6086 CDD:472250
Ig strand B 6014..6018 CDD:409353
Ig strand C 6028..6032 CDD:409353
Ig strand E 6050..6056 CDD:409353
Ig strand F 6066..6071 CDD:409353
Ig strand G 6079..6082 CDD:409353
Ig 6107..6187 CDD:472250
Ig strand B 6115..6119 CDD:409353
Ig strand C 6128..6132 CDD:409353
Ig strand E 6153..6157 CDD:409353
Ig strand F 6167..6172 CDD:409353
Ig strand G 6180..6183 CDD:409353
FN3 6216..6310 CDD:238020
I-set 6321..6412 CDD:400151
Ig strand B 6339..6343 CDD:409353
Ig strand C 6352..6356 CDD:409353
Ig strand E 6375..6382 CDD:409353
Ig strand F 6392..6397 CDD:409353
Ig strand G 6405..6408 CDD:409353
I-set 6442..6531 CDD:400151
Ig strand B 6459..6463 CDD:409353
Ig strand C 6472..6476 CDD:409353
Ig strand E 6497..6501 CDD:409353
Ig strand F 6511..6516 CDD:409353
Ig strand G 6524..6527 CDD:409353
Ig 6541..6632 CDD:472250
Ig strand B 6559..6563 CDD:409353
Ig strand C 6572..6576 CDD:409353
Ig strand E 6598..6602 CDD:409353
Ig strand F 6612..6617 CDD:409353
Ig strand G 6625..6628 CDD:409353
Ig 6662..6754 CDD:472250
Ig strand B 6679..6683 CDD:409353
Ig strand C 6692..6696 CDD:409353
Ig strand E 6720..6724 CDD:409353
Ig strand F 6734..6739 CDD:409353
I-set 6779..6868 CDD:400151
Ig strand B 6796..6800 CDD:409353
Ig strand C 6809..6813 CDD:409353
Ig strand E 6834..6838 CDD:409353
Ig strand F 6848..6853 CDD:409353
I-set 6939..7028 CDD:400151
Ig strand B 6956..6960 CDD:409353
Ig strand C 6969..6973 CDD:409353
Ig strand E 6993..6998 CDD:409353
Ig strand F 7008..7013 CDD:409353
Ig strand G 7021..7024 CDD:409353
IG_like 7075..7140 CDD:214653
Ig strand C 7082..7086 CDD:409353
Ig strand E 7107..7111 CDD:409353
Ig strand F 7121..7126 CDD:409353
Ig strand G 7135..7138 CDD:409353
Ig 7173..7232 CDD:409353
Ig strand C 7184..7188 CDD:409353
Ig strand E 7210..7214 CDD:409353
Ig strand F 7224..7229 CDD:409353
IG_like 7406..7475 CDD:214653
Ig strand B 7413..7417 CDD:409353
Ig strand C 7426..7430 CDD:409353
Ig strand E 7451..7455 CDD:409353
Ig strand F 7465..7470 CDD:409353
FN3 7489..7588 CDD:238020
STKc_MLCK 7626..7876 CDD:271005
nexnXP_073765877.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.