| Sequence 1: | NP_001261019.1 | Gene: | Strn-Mlck / 36753 | FlyBaseID: | FBgn0265045 | Length: | 8255 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001262320.1 | Gene: | dpr11 / 40800 | FlyBaseID: | FBgn0053202 | Length: | 360 | Species: | Drosophila melanogaster |
| Alignment Length: | 287 | Identity: | 70/287 - (24%) |
|---|---|---|---|
| Similarity: | 104/287 - (36%) | Gaps: | 96/287 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5621 SAGQLSVLDQSTGKLPE----SFSSGIIESYDDQ----------RNEIVLSCQV--IGRPSVSW- 5668
Fly 5669 -MRDDH--------SICNNRYRTIEEPGGVRKLVIRNPISSDCGIFACYAEHEDRIDSTSITIKA 5724
Fly 5725 ADLKRLINVSQEEIPSIGDHESTPWSRSQSHLSSGSQVNGNGELHRAGDRVLRNVGKGKPLFHTL 5789
Fly 5790 LHDRTVSEGANLRLVCSVSG--DENTHIEWLKNHKPLPRSDNRYQTVY------LNGE-----AS 5841
Fly 5842 LEIFAAVADDSGNYTCCATNDFGESLT 5868 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Strn-Mlck | NP_001261019.1 | IG_like | 51..127 | CDD:214653 | |
| Ig | <69..>112 | CDD:299845 | |||
| I-set | 137..226 | CDD:254352 | |||
| I-set | 235..314 | CDD:254352 | |||
| Ig_2 | 244..314 | CDD:290606 | |||
| I-set | 438..513 | CDD:254352 | |||
| Ig | 454..510 | CDD:143165 | |||
| I-set | 537..626 | CDD:254352 | |||
| Ig | 555..618 | CDD:299845 | |||
| I-set | 636..713 | CDD:254352 | |||
| Ig | 652..712 | CDD:143165 | |||
| SMC_N | <2190..2854 | CDD:280601 | |||
| I-set | 5300..5388 | CDD:254352 | |||
| IGc2 | 5313..5378 | CDD:197706 | |||
| IG | 5412..5482 | CDD:214652 | |||
| IGc2 | 5413..5481 | CDD:197706 | |||
| I-set | 5542..5627 | CDD:254352 | 2/5 (40%) | ||
| Ig | 5556..5621 | CDD:143165 | 70/287 (24%) | ||
| Ig | 5654..5721 | CDD:143165 | 21/78 (27%) | ||
| I-set | 5784..5874 | CDD:254352 | 30/98 (31%) | ||
| IGc2 | 5797..5864 | CDD:197706 | 25/79 (32%) | ||
| I-set | 5887..5970 | CDD:254352 | |||
| Ig | 5902..5966 | CDD:143165 | |||
| I-set | 5997..6086 | CDD:254352 | |||
| Ig | 6026..6083 | CDD:143165 | |||
| I-set | 6097..6187 | CDD:254352 | |||
| Ig | 6114..6187 | CDD:299845 | |||
| FN3 | 6216..6310 | CDD:238020 | |||
| I-set | 6321..6412 | CDD:254352 | |||
| Ig | 6328..6412 | CDD:299845 | |||
| I-set | 6442..6531 | CDD:254352 | |||
| Ig | 6459..6528 | CDD:143165 | |||
| I-set | 6541..6632 | CDD:254352 | |||
| IGc2 | 6555..6622 | CDD:197706 | |||
| I-set | 6662..6754 | CDD:254352 | |||
| Ig | 6679..6751 | CDD:143165 | |||
| I-set | 6779..6868 | CDD:254352 | |||
| IGc2 | 6793..6858 | CDD:197706 | |||
| Ig | 6938..7022 | CDD:299845 | |||
| I-set | 6939..7028 | CDD:254352 | |||
| IG | 7075..7140 | CDD:214652 | |||
| Ig | 7075..7140 | CDD:143165 | |||
| IG | 7167..7239 | CDD:214652 | |||
| Ig | 7173..7239 | CDD:143165 | |||
| Ig | 7392..7475 | CDD:299845 | |||
| IG | 7406..7475 | CDD:214652 | |||
| FN3 | 7489..7588 | CDD:238020 | |||
| S_TKc | 7620..7876 | CDD:214567 | |||
| STKc_MLCK | 7626..7876 | CDD:271005 | |||
| dpr11 | NP_001262320.1 | I-set | 125..216 | CDD:254352 | 22/98 (22%) |
| Ig | 127..217 | CDD:299845 | 22/97 (23%) | ||
| IG_like | 227..320 | CDD:214653 | 30/98 (31%) | ||
| IGc2 | 234..311 | CDD:197706 | 24/76 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||