DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and otk

DIOPT Version :9

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster


Alignment Length:788 Identity:152/788 - (19%)
Similarity:266/788 - (33%) Gaps:234/788 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  5546 KTMTIGSGNKAQLICYVTGIIEDVH--WLRNDERVTKDARHKIYNINGAISLEIYDARVEDSGHY 5608
            ::.::......:..|..|....::|  ||.|..|:..|.|  ::.|...:.:|.. .|.||.|:|
  Fly    32 QSQSVVENESVKFECESTDSYSELHYDWLHNGHRIAYDKR--VHQIGSNLHIEAV-RRTEDVGNY 93

  Fly  5609 RCVVKNSRQTVESA---GQLSVLDQSTGKLPESFSSGIIESYDDQRNEIVLSCQVIGRP------ 5664
            .|:..|.......|   .:|||:         ...|..::.....|||::|.|.|.|..      
  Fly    94 VCIATNLASGAREASPPAKLSV
I---------YLESASVQLLGSNRNELLLKCHVEGASGDLEPL 149

  Fly  5665 SVSWMRDDHSICNNRYRTIEEPGGVRKLVIRNPISSDCGIFACYAEH-EDRIDSTSITIKAADLK 5728
            .:.|.|:...:...:...:::    .:|:||.|.|.|.|::.|.|.: ..|:.|....:..:.:|
  Fly   150 EIEWYRNSEKLSTWKNVQLDQ----HRLIIRQPGSEDDGLYRCTASNAAGRVMSKQGYVYQSSVK 210

  Fly  5729 RLINVSQEEIPSIGDHESTPWSRSQSHLSSGSQVNGNG-ELHRAGDRVLRNVGKGKPLFHTLLHD 5792
            .|..:.:.:    .:.....|.: |:.|..|.:....| |...|....||.| :| |:..::   
  Fly   211 CLPRLPRRK----NEKMMESWDK-QTFLCRGKRGGAAGLEALPAAPEDLRIV-QG-PIGQSI--- 265

  Fly  5793 RTVSEGANLRLVCSVS-----GDENTHIEWLKNHK-----------PLP------------RSDN 5829
              :.||....|.|...     .::...:.|.|:.|           |:|            |.|.
  Fly   266 --IKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDA 328

  Fly  5830 RYQTVYLNGEASLEIFAAVADDSGNYTCCATNDFGESLTHAQ-------LRVYKNFKEAPLPSTF 5887
            |......||  :|...:.:|.|:|.|.|....:     .||.       |.|.:..|..|     
  Fly   329 RLVLHKQNG--TLSFASIIASDAGQYQCQLQLE-----AHAPINSSPGILEVIEQLKFVP----- 381

  Fly  5888 TQPIRDTYSLNENELVLDCRVRGQPRPEIQWIKGTEPIEASEKFKPSDQADGYAKLVIVNPTEKD 5952
             ||......|:.....:.|:.:|.|.|::||::..|.....:..    :.|....|:..|...:.
  Fly   382 -QPTSKNLELDAVVAKVHCKAQGTPTPQVQWVRDGENTTLPDHV----EVDANGTLIFRNVNSEH 441

  Fly  5953 SGIYWCVARNEGAENKISHQVDFKGRQHYSLEKTHGFFHRDPNKPHFLLPLGNQTVCNGGTVAIS 6017
            .|.|.|:|.|...:...:..::......:|:.                 |:|.......|||.:.
  Fly   442 RGNYTCLATNSQGQINATVAINVVVTPKFSVP-----------------PVGPIETSEQGTVVMH 489

  Fly  6018 AEFMETSTPIEVKWLRDRRVVDGPNVKALADRGVY------TLTIMNAGPEVEGTYTCRASNAFG 6076
            .:.:....| .::|.:|.:.:...|    .||..:      ||.|.|...|.||:|.|...|:.|
  Fly   490 CQAIGDPKP-TIQWDKDLKYLSENN----TDRERFRFLENGTLEIRNVQVEDEGSYGCTIGNSAG 549

  Fly  6077 RIESNVNVDVAVGAEKDERPPLFLSRPDTEMKI-AVGDPFS------------------------ 6116
                                   |.|.|.::.: ..||.|:                        
  Fly   550 -----------------------LKREDVQLVVKTTGDGFAPEESGGDGFLVTRAVLITMTVALA 591

  Fly  6117 -------------------------LSFRIAGDPKPKL----------------------TFMKG 6134
                                     ||.:.||..:|.:                      :..|.
  Fly   592 YIVLVVGLMLWCRYRRQARKARLNDLSTKEAGGDQPDVAGNGKGSEQEPCLSKQHNGHSKSRSKS 656

  Fly  6135 TKDITQSD--------RVSKEVSDDYTRFSVQQAQISDSGTYFVVARNNFGTDRIFV-----TVT 6186
            :.|..:||        |.||:.:..|.:.::.::.:|:   ...:.|..||.  :||     |:.
  Fly   657 SGDAQKSDDTACSQQSRASKKSAHIYEQLALPRSGLSE---LIQIGRGEFGD--VFVGKLKATLV 716

  Fly  6187 VNPRARSA 6194
            .:|..:.|
  Fly   717 TSPSDKDA 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352
IGc2 5313..5378 CDD:197706
IG 5412..5482 CDD:214652
IGc2 5413..5481 CDD:197706
I-set 5542..5627 CDD:254352 20/85 (24%)
Ig 5556..5621 CDD:143165 18/66 (27%)
Ig 5654..5721 CDD:143165 17/73 (23%)
I-set 5784..5874 CDD:254352 24/124 (19%)
IGc2 5797..5864 CDD:197706 20/94 (21%)
I-set 5887..5970 CDD:254352 18/82 (22%)
Ig 5902..5966 CDD:143165 15/63 (24%)
I-set 5997..6086 CDD:254352 22/94 (23%)
Ig 6026..6083 CDD:143165 17/62 (27%)
I-set 6097..6187 CDD:254352 26/174 (15%)
Ig 6114..6187 CDD:299845 21/156 (13%)
FN3 6216..6310 CDD:238020
I-set 6321..6412 CDD:254352
Ig 6328..6412 CDD:299845
I-set 6442..6531 CDD:254352
Ig 6459..6528 CDD:143165
I-set 6541..6632 CDD:254352
IGc2 6555..6622 CDD:197706
I-set 6662..6754 CDD:254352
Ig 6679..6751 CDD:143165
I-set 6779..6868 CDD:254352
IGc2 6793..6858 CDD:197706
Ig 6938..7022 CDD:299845
I-set 6939..7028 CDD:254352
IG 7075..7140 CDD:214652
Ig 7075..7140 CDD:143165
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020
S_TKc 7620..7876 CDD:214567
STKc_MLCK 7626..7876 CDD:271005
otkNP_523705.2 I-set 26..115 CDD:254352 20/85 (24%)
Ig 31..115 CDD:299845 20/85 (24%)
IGc2 133..195 CDD:197706 15/65 (23%)
Ig 268..373 CDD:299845 23/111 (21%)
Ig 395..460 CDD:143165 15/68 (22%)
I-set 468..559 CDD:254352 26/135 (19%)
IGc2 484..549 CDD:197706 19/69 (28%)
PTK_CCK4 686..1026 CDD:133178 9/44 (20%)
STYKc 692..1020 CDD:214568 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.