DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and LRIT3

DIOPT Version :9

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_940908.3 Gene:LRIT3 / 345193 HGNCID:24783 Length:679 Species:Homo sapiens


Alignment Length:641 Identity:112/641 - (17%)
Similarity:196/641 - (30%) Gaps:251/641 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly  6430 HGRN--------------VADVGDSLPIFTMRLRDRRVQVTYPVRLTCQIVGYPVP-EILWYKDD 6479
            ||||              :.::..:||:.|::|   |::.|...|::.:...|.|. :.||...:
Human    30 HGRNDGSGSRLVLCNDMDMNELPTNLPVDTVKL---RIEKTVIRRISAEAFYYLVELQYLWVTYN 91

  Fly  6480 ELIHTDRKHLISAEGQFFTLEIAATTLDDSGTYTCLARNELGSVSCH---CTLVVDKGIR----- 6536
            .:...|.....:.: |...|.:...:|......:.|....|.::..|   .|.|.::.:|     
Human    92 SVASIDPSSFYNLK-QLHELRLDGNSLAAFPWASLLDMPLLRTLDLHNNKITSVPNEALRYLKNL 155

  Fly  6537 AYIS----------PDFYVPLDPFYIFREGSEIRLSTKVEAYPSVGVTWHRNGMRLRPSRRLTAT 6591
            ||:.          |||               :...|.:.:.|| ||      :.|.|||.:...
Human   156 AYLDLSSNRLTTLPPDF---------------LESWTHLVSTPS-GV------LDLSPSRIILGL 198

  Fly  6592 LDS----NGYVELIIAEATVRDAGIYVCVASNVVGKVETICRVAVEEAENKAVAPQRSLEIPSIK 6652
            .|:    :.::..:|..:.|.|..|.:........:.|.:..:..:.||                
Human   199 QDNPWFCDCHISKMIELSKVVDPAIVLLDPLMTCSEPERLTGILFQRAE---------------- 247

  Fly  6653 TDDLPYSKEPLFVVKPRSSEAYEGDNVIIFCEVVGDPKPEVVWLRDFLNPEYYKDAPHFRRIGDG 6717
               |.:..:|..:.......:..|.||::.|:..|.|.|::.|.|...:|.              
Human   248 ---LEHCLKPSVMTSATKIMSALGSNVLLRCDATGFPTPQITWTRSDSSPV-------------- 295

  Fly  6718 PEYRLEIPSAKLDFTGTYSVIASNCHGEAKAVISLQIFAKDILNKSRMDKVHTRHGNIETLPRFV 6782
                            .|:||                                            
Human   296 ----------------NYTVI-------------------------------------------- 300

  Fly  6783 RNLRNLRCCDGDAISLECHVEADPEPFIIWEKDGHVMPSDRDYVMSFDGTKATLSIPRVYPEDEG 6847
                                :..||..:.|.            :||..|         :..:|.|
Human   301 --------------------QESPEEGVRWS------------IMSLTG---------ISSKDAG 324

  Fly  6848 EYTCVAKNSVGRSLSSACIIVDV---------PEEKENM-------------LSRQLARPSGLL- 6889
            :|.|.|||..|  :|.|.:.|.|         |:..|..             .|..::..|..| 
Human   325 DYKCKAKNLAG--MSEAVVTVTVLGITTTPIPPDTSERTGDHPEWDVQPGSGRSTSVSSASSYLW 387

  Fly  6890 -------SAHSTPRSTPRSTPARSFSPLRLSYRTSSIDLSGVAERRRSDARNAITAPKFLAIPYN 6947
                   |:.|....:|.||.:.|.||...|..:|:..||           .:|:|...:|...:
Human   388 SSSFSPTSSFSASTLSPPSTASFSLSPFSSSTVSSTTTLS-----------TSISASTTMANKRS 441

  Fly  6948 RVVEEGDSVRFQCAISGHPTPWATWDK-------DGLIVTPTPRIAVKEIDDLRII 6996
            ..:.:|.....:.|.:|...|.|:..|       |..::|.|.    ..|::||::
Human   442 FQLHQGGKRNLKVAKNGSKLPPASTSKKEELALLDQTMLTETN----AAIENLRVV 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352
IGc2 5313..5378 CDD:197706
IG 5412..5482 CDD:214652
IGc2 5413..5481 CDD:197706
I-set 5542..5627 CDD:254352
Ig 5556..5621 CDD:143165
Ig 5654..5721 CDD:143165
I-set 5784..5874 CDD:254352
IGc2 5797..5864 CDD:197706
I-set 5887..5970 CDD:254352
Ig 5902..5966 CDD:143165
I-set 5997..6086 CDD:254352
Ig 6026..6083 CDD:143165
I-set 6097..6187 CDD:254352
Ig 6114..6187 CDD:299845
FN3 6216..6310 CDD:238020
I-set 6321..6412 CDD:254352
Ig 6328..6412 CDD:299845
I-set 6442..6531 CDD:254352 18/92 (20%)
Ig 6459..6528 CDD:143165 12/72 (17%)
I-set 6541..6632 CDD:254352 18/94 (19%)
IGc2 6555..6622 CDD:197706 14/70 (20%)
I-set 6662..6754 CDD:254352 14/91 (15%)
Ig 6679..6751 CDD:143165 11/71 (15%)
I-set 6779..6868 CDD:254352 16/88 (18%)
IGc2 6793..6858 CDD:197706 13/64 (20%)
Ig 6938..7022 CDD:299845 14/66 (21%)
I-set 6939..7028 CDD:254352 13/65 (20%)
IG 7075..7140 CDD:214652
Ig 7075..7140 CDD:143165
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020
S_TKc 7620..7876 CDD:214567
STKc_MLCK 7626..7876 CDD:271005
LRIT3NP_940908.3 LRR 1 56..79 6/25 (24%)
leucine-rich repeat 59..82 CDD:275378 6/25 (24%)
LRR_8 61..117 CDD:290566 11/59 (19%)
LRR 2 80..103 4/22 (18%)
leucine-rich repeat 83..106 CDD:275378 3/23 (13%)
LRR 3 104..128 4/24 (17%)
LRR_8 105..165 CDD:290566 11/60 (18%)
LRR_4 105..146 CDD:289563 8/41 (20%)
leucine-rich repeat 107..130 CDD:275378 3/22 (14%)
LRR 4 129..151 4/21 (19%)
LRR_4 131..170 CDD:289563 7/38 (18%)
leucine-rich repeat 131..154 CDD:275378 5/22 (23%)
LRR 5 152..175 5/37 (14%)
leucine-rich repeat 155..168 CDD:275378 2/12 (17%)
Ig 267..345 CDD:299845 30/194 (15%)
IG_like 267..345 CDD:214653 30/194 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..375 2/23 (9%)
FN3 486..550 CDD:214495 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.