DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and Fas2

DIOPT Version :9

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:833 Identity:183/833 - (21%)
Similarity:289/833 - (34%) Gaps:220/833 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  5553 GNKAQLICYVT----GIIEDVHWLRNDERVTKDARHK--IYNING--------------AISLEI 5597
            |....|.|..|    .::.|:.|        ||.|:.  :...||              :::|.|
  Fly    47 GKPLILTCRPTVPEPSLVADLQW--------KDNRNNTILPKPNGRNQPPMYTETLPGESLALMI 103

  Fly  5598 YDARVEDSGHYRCVVKNSRQTVESAGQL--SVLDQSTGKLPESFSSGIIESYDDQRNEIVLSCQV 5660
            ....||..|.|.|....:...:...|..  :.:..:....||:       .|.....:.|:.|:|
  Fly   104 TSLSVEMGGKYYCTASYANTEILEKGVTIK
TYVAITWTNAPEN-------QYPTLGQDYVVMCEV 161

  Fly  5661 IG--RPSVSWMRDDHSICNNRYRTIEEPGGVRKLVIRNPISSDCGIFACYAEHEDRIDSTSITIK 5723
            ..  .|::.|:|:...|.....:.:.:..|   |:|||...||.||:.|.|          ..|:
  Fly   162 KADPNPTIDWLRNGDPIRTTNDKYVVQTNG---LLIRNVQESDEGIYTCRA----------AVIE 213

  Fly  5724 AAD-LKRLINVS---QEEIPSIGDHESTPWSRSQSHLSSGSQVNGNGELHRAGDRVLRNVGKGKP 5784
            ..: |:|.|.|.   |.||.|:..:                               |..| :|||
  Fly   214 TGELLERTIRVEVFIQPEIISLPTN-------------------------------LEAV-EGKP 246

  Fly  5785 LFHTLLHDRTVSEGANLRLVCSVSGDENTHIEWLKNHKPL-PRSDNRYQTVYLNGEASLEIFAAV 5848
            .            .||    |:..|.....|.|:::...| ..:.:|:|   :|.:..|...::|
  Fly   247 F------------AAN----CTARGKPVPEISWIRDATQLNVATADRFQ---VNPQTGLVTISSV 292

  Fly  5849 A-DDSGNYTCCATNDFGESLTHAQLRVYKNFKEAPLPSTFTQP-IRDTYSL---NENELVLDCRV 5908
            : ||.|.|||.|.|..|......:|.|            ..:| |.:.|::   ...|:.:.||.
  Fly   293 SQDDYGTYTCLAKNRAGVVDQKTKLNV------------LVRPQIYELYNVTGARTKEIAITCRA 345

  Fly  5909 RGQPRPEI---QWIKGTEPIEASEKFKP---------SDQADGYAKLVIVNPTEKDSGIYWCVAR 5961
            :|:|.|.|   :|....|.....:...|         .::.:....|.|.|....|.|:|.|:||
  Fly   346 KGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGESTGTLRISNAERSDDGLYQCIAR 410

  Fly  5962 NEGAENKISHQVDFKGRQHYSLEKTHGFFHRDPNKPHFLLPLGNQTVCNGGTVAISAEFMETSTP 6026
            |:||        |.....|.::|....|.|.....|.|   ...|...|...:|:..    .:..
  Fly   411 NKGA--------DAYKTGHITVEFAPDFSHMKELPPVF---SWEQRKANLSCLAMGI----PNAT 460

  Fly  6027 IEVKWLRDRRVVDGPNVKALADRGVYTLTIMNAGPEVE-----------GTYTCRASNAFGRIES 6080
            ||..|       :|..:|.|.|.   .|.|:..||..:           ..|.|.|:|..|..|.
  Fly   461 IEWHW-------NGRKIKDLYDT---NLKIVGTGPRSDLIVHPVTRQYYSGYKCIATNIHGTAEH 515

  Fly  6081 NVNVDVAVGAEKDERPPLFLSRPDTEMKIAVGDPFSLSFRIAGDPKPKLTFMKGTKDITQSDRVS 6145
            ::.:       |:.|.|.|:|........|.    :::|.|.| |..:|........:...:.::
  Fly   516 DMQL-------KEARVPDFVSEAKPSQLTAT----TMTFDIRG-PSTELGLPILAYSVQYKEALN 568

  Fly  6146 KEVSDDYTR-------FSVQQAQISDSGTYFVVARNNFGTDRIFVTVTVNPRARSATPTQPRWGL 6203
            .:.|..|.|       :.|:..:.....::...|||..|.....|....:...||| |.:|:   
  Fly   569 PDWSTAYNRSWSPDSPYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSA-PEEPK--- 629

  Fly  6204 PLDSYSDTSYFRDPPGCISTEPLVVDSGPTHISLSWGKPVSANSAPVMAYKVEAWVVGHEGGAYW 6268
            ||         .:|......||:||.....|..|.||.|.. |..|:..|::: :..|.:....|
  Fly   630 PL---------HNPVQHDKEEPVVVSPYSDHFELRWGVPAD-NGEPIDRYQIK-YCPGVKISGTW 683

  Fly  6269 REL-------GLTPINSFDAFNLKPNVEYHFRVTPKNRYGWGPTVQTSSPLQV 6314
            .||       .:....||:...|..|..|...:...|..|:      |||..:
  Fly   684 TELENSCNTVEVMETTSFEMTQLVGNTYYRIELKAHNAIGY------SSPASI 730

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352
IGc2 5313..5378 CDD:197706
IG 5412..5482 CDD:214652
IGc2 5413..5481 CDD:197706
I-set 5542..5627 CDD:254352 19/95 (20%)
Ig 5556..5621 CDD:143165 17/84 (20%)
Ig 5654..5721 CDD:143165 18/68 (26%)
I-set 5784..5874 CDD:254352 23/91 (25%)
IGc2 5797..5864 CDD:197706 20/68 (29%)
I-set 5887..5970 CDD:254352 25/98 (26%)
Ig 5902..5966 CDD:143165 20/75 (27%)
I-set 5997..6086 CDD:254352 22/99 (22%)
Ig 6026..6083 CDD:143165 17/67 (25%)
I-set 6097..6187 CDD:254352 18/96 (19%)
Ig 6114..6187 CDD:299845 14/79 (18%)
FN3 6216..6310 CDD:238020 24/100 (24%)
I-set 6321..6412 CDD:254352
Ig 6328..6412 CDD:299845
I-set 6442..6531 CDD:254352
Ig 6459..6528 CDD:143165
I-set 6541..6632 CDD:254352
IGc2 6555..6622 CDD:197706
I-set 6662..6754 CDD:254352
Ig 6679..6751 CDD:143165
I-set 6779..6868 CDD:254352
IGc2 6793..6858 CDD:197706
Ig 6938..7022 CDD:299845
I-set 6939..7028 CDD:254352
IG 7075..7140 CDD:214652
Ig 7075..7140 CDD:143165
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020
S_TKc 7620..7876 CDD:214567
STKc_MLCK 7626..7876 CDD:271005
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 19/93 (20%)
IG_like 144..226 CDD:214653 26/101 (26%)
IGc2 152..209 CDD:197706 17/59 (29%)
I-set 230..319 CDD:254352 30/139 (22%)
IGc2 243..309 CDD:197706 23/84 (27%)
IG_like 330..424 CDD:214653 24/101 (24%)
IGc2 339..412 CDD:197706 18/72 (25%)
Ig 447..518 CDD:143165 19/84 (23%)
fn3 534..611 CDD:278470 14/81 (17%)
FN3 640..735 CDD:238020 26/99 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.