DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and Lsamp

DIOPT Version :9

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:398 Identity:91/398 - (22%)
Similarity:146/398 - (36%) Gaps:103/398 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  6203 LPLDSYSDTSYFRDPPGCISTEPLVVDSGPTHISLSWGK-----PVSANSAPVMAYKVE------ 6256
            |.|.|....:::..||..::..|:.:...|.. |:.:.:     .|......::...||      
  Rat    16 LSLFSLQVLAFWNQPPAEVNLSPITIPGLPVR-SVDFNRGTDNITVRQGDTAILRCVVEDKNSKV 79

  Fly  6257 AWV-------VGHEGGAYWRELGLTPINSFDAFNLKPNV--------EYHFRVTPKNRYGWGP-- 6304
            ||:       .||                 |.::|.|.|        ||..|:...:.|..|.  
  Rat    80 AWLNRSGIIFAGH-----------------DKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYT 127

  Fly  6305 -TVQTS---SPLQVGGVECLPEFVKILPGQAKALLGSSFTLQCNMRGAPRPQVTWFKDGIQLSSS 6365
             :|||.   ...||..:..:|..:..:........||:.||.|...|.|.|.:|| :....|...
  Rat   128 CSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITW-RHLTPLGRE 191

  Fly  6366 SERVKIRQIGSTCALTIATVSELDSGRYTCEATNSKGRVSTFARLQVVSDSRIYE---ADSRLKE 6427
            .|       |....|.|..::...||:|.|:|.|   .||: |.::.|..:..|.   .:|:..|
  Rat   192 FE-------GEEEYLEILGITREQSGKYECKAAN---EVSS-ADVKQVKVTVNYPPTITESKSNE 245

  Fly  6428 IAHGRNVADVGDSLPIFTMRLRDRRVQVTYPVRLTCQIVGYPVPEILWYKDDELIHT-DRKHLIS 6491
            ...||..:                         |.|:....|.|:..||:||..|:: :...:.|
  Rat   246 ATTGRQAS-------------------------LKCEASAVPAPDFEWYRDDTRINSANGLEIKS 285

  Fly  6492 AEGQFFTLEIAATTLDDSGTYTCLARNELGSVSCHCTLVVDKGIRAYISPDFYVPLDPFYIFREG 6556
            .||| .:|.:...|.:..|.|||:|.|:||..  :.:||:.|.:         :|..|..|...|
  Rat   286 TEGQ-SSLTVTNVTEEHYGNYTCVAANKLGVT--NASLVLFKRV---------LPTVPHPIQEIG 338

  Fly  6557 SEIRLSTK 6564
            :.:....|
  Rat   339 TTVHFKQK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653
Ig <69..>112 CDD:299845
I-set 137..226 CDD:254352
I-set 235..314 CDD:254352
Ig_2 244..314 CDD:290606
I-set 438..513 CDD:254352
Ig 454..510 CDD:143165
I-set 537..626 CDD:254352
Ig 555..618 CDD:299845
I-set 636..713 CDD:254352
Ig 652..712 CDD:143165
SMC_N <2190..2854 CDD:280601
I-set 5300..5388 CDD:254352
IGc2 5313..5378 CDD:197706
IG 5412..5482 CDD:214652
IGc2 5413..5481 CDD:197706
I-set 5542..5627 CDD:254352
Ig 5556..5621 CDD:143165
Ig 5654..5721 CDD:143165
I-set 5784..5874 CDD:254352
IGc2 5797..5864 CDD:197706
I-set 5887..5970 CDD:254352
Ig 5902..5966 CDD:143165
I-set 5997..6086 CDD:254352
Ig 6026..6083 CDD:143165
I-set 6097..6187 CDD:254352
Ig 6114..6187 CDD:299845
FN3 6216..6310 CDD:238020 24/125 (19%)
I-set 6321..6412 CDD:254352 25/90 (28%)
Ig 6328..6412 CDD:299845 24/83 (29%)
I-set 6442..6531 CDD:254352 24/89 (27%)
Ig 6459..6528 CDD:143165 23/69 (33%)
I-set 6541..6632 CDD:254352 5/24 (21%)
IGc2 6555..6622 CDD:197706 2/10 (20%)
I-set 6662..6754 CDD:254352
Ig 6679..6751 CDD:143165
I-set 6779..6868 CDD:254352
IGc2 6793..6858 CDD:197706
Ig 6938..7022 CDD:299845
I-set 6939..7028 CDD:254352
IG 7075..7140 CDD:214652
Ig 7075..7140 CDD:143165
IG 7167..7239 CDD:214652
Ig 7173..7239 CDD:143165
Ig 7392..7475 CDD:299845
IG 7406..7475 CDD:214652
FN3 7489..7588 CDD:238020
S_TKc 7620..7876 CDD:214567
STKc_MLCK 7626..7876 CDD:271005
LsampXP_038944182.1 Ig 55..145 CDD:416386 21/106 (20%)
FR1 55..71 CDD:409353 1/15 (7%)
Ig strand A' 56..62 CDD:409353 1/5 (20%)
Ig strand B 64..72 CDD:409353 0/7 (0%)
CDR1 72..76 CDD:409353 2/3 (67%)
FR2 77..84 CDD:409353 2/6 (33%)
Ig strand C 77..83 CDD:409353 2/5 (40%)
CDR2 85..95 CDD:409353 3/26 (12%)
Ig strand C' 87..90 CDD:409353 0/2 (0%)
Ig strand C' 92..95 CDD:409353 2/19 (11%)
FR3 96..131 CDD:409353 8/34 (24%)
Ig strand D 100..107 CDD:409353 1/6 (17%)
Ig strand E 110..116 CDD:409353 3/5 (60%)
Ig strand F 123..131 CDD:409353 1/7 (14%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 2/8 (25%)
FR4 138..145 CDD:409353 2/6 (33%)
Ig_3 148..218 CDD:404760 21/77 (27%)
Ig strand A' 155..160 CDD:409353 0/4 (0%)
Ig strand B 166..173 CDD:409353 3/6 (50%)
Ig strand C 179..184 CDD:409353 2/5 (40%)
Ig strand D 190..193 CDD:409353 0/2 (0%)
Ig strand E 197..203 CDD:409353 2/5 (40%)
Ig strand F 210..217 CDD:409353 3/6 (50%)
Ig strand G 224..232 CDD:409353 1/7 (14%)
Ig_3 235..311 CDD:404760 24/101 (24%)
Ig strand B 252..256 CDD:409353 1/28 (4%)
Ig strand C 265..269 CDD:409353 0/3 (0%)
Ig strand E 290..294 CDD:409353 1/3 (33%)
Ig strand F 304..309 CDD:409353 3/4 (75%)
Ig strand G 318..321 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.