DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and zormin

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_001261317.1 Gene:zormin / 2769001 FlyBaseID:FBgn0052311 Length:3664 Species:Drosophila melanogaster


Alignment Length:4248 Identity:762/4248 - (17%)
Similarity:1399/4248 - (32%) Gaps:1302/4248 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  3833 QESQKEEVKDSEAKPKKAKVLEK--KSIEEEKLEDKKEKQTES---AIDEKSQKAE---VSEIVS 3889
            |..:|..:|..|.:||...:.|.  :|:..::..|:..:..:|   .:||..|||:   .|:.:|
  Fly   115 QSPEKIYIKVVELEPKITALGENLDESLRMQREHDETLRNLQSLPGPMDEFVQKADKLLASKRIS 179

  Fly  3890 EKITDEKA--------------QESQKKEVKGSEAKPKKAKVLEK-KSIE---EEKLEDKKEKQT 3936
            .::.:..|              |:.|...:..::...|..:...| ..:|   ||.|......:.
  Fly   180 SELVNAMADTLNIIWQDILNLLQDRQHLLILCTQFHDKMTQCFRKMDQLELACEETLHPPDVPRV 244

  Fly  3937 ESAIDE-KSQKAEVSEIVSEKITDEK---AQESQMEEVKDSEAKPKKAKVLEKKSIE--EEKLEN 3995
            :..::. |..:.::...|...:.|..   ||..::|:::..:.:|:..|....:::.  ::.||.
  Fly   245 QEFLNRFKQLRIDMLTGVMAALKDGNELLAQLEELEKLETLDTRPEHIKRDATRAVHQVQQWLEA 309

  Fly  3996 KKEKQTESAIDEKSQKAEVSEIVSEKITDEKAQESQKKEVKDSEAKPKKAKVLEKKSIEEEKLED 4060
            ..:::....:..:::|.::.:.::..:..        :|:.|.||..::|::             
  Fly   310 LHDRRNSLELAWQTRKIQMEQCLALALLG--------RELVDLEAALQQARM------------- 353

  Fly  4061 KKEKQTESAIDEKSQKAEVSEIVSENITDEKAQESQKKEVKDSEAKPKKAKVLEKKSIEEEKLED 4125
              |..|..::.|....|      :|.:|..:..:.|...::|...|..:||         ||::.
  Fly   354 --ELNTMYSLGECEHTA------NEMLTKYREWKQQALLLRDRALKITRAK---------EKVQS 401

  Fly  4126 KKE-TQTDSA----------------IDEKSQ----------KAEVSEIVSEKITDEKAQESQKE 4163
            ... |:.|:.                :|::..          |||.:..|.||:      |.:..
  Fly   402 AGHFTEEDACARAYAVLSGCTEHLDLVDQREHWLHQSREFFAKAEHTVSVLEKL------ELELT 460

  Fly  4164 EVKDSEAKPKKAKVLEK-----KSIEEEKLE---------DKKEKQTES---AIDEKSQKAEVSE 4211
            .||.....|:...:..|     ::..||.|.         .:.:.:|:.   .:||    .|..:
  Fly   461 SVKLPPHSPESYAMFSKVDRDVRNFTEEPLRLGYGILDEVGRTQPETQGVKRVLDE----LENRK 521

  Fly  4212 IVSENITDEKAQESQKKEVKDSEAKPKKAKVLE----------KKSIE-EEKLEDKKE--KQTES 4263
            :..:.|....:::.||.:...||......::|.          ::|:: ...|:..|:  .|...
  Fly   522 VYIQGICANSSEDQQKVQRALSEFLNHHNELLAWLRASGQHQLQQSVDMGGNLQQAKQFLLQHHE 586

  Fly  4264 AIDEKSQKAEVSEIVSE--KITEEKAQESQKKEVKDSKAKPKKAKVLEKKSIEEAKLEDKKETQT 4326
            .:.:...|.|:..::.|  |:..|.....::.:| ||||:.     |.|..||...|..|:    
  Fly   587 LMQDLEIKGELINLLLESIKVHLESLSPQERYDV-DSKAES-----LHKHWIELKDLVLKR---- 641

  Fly  4327 DSAIDEKSQKAEVSEIVSEKITDEKAQESQKEEVKDSEAKPKKAKVLEKKSIEEEKLENKKEKQT 4391
               :|..|...:..|:.:|..:.....:.|.::..|                 |.||:..:...|
  Fly   642 ---VDYVSLLIDFFELANELSSQLDNLQRQLQQTPD-----------------EHKLQFLQATWT 686

  Fly  4392 ESAIDEKSQKAEVSEIVSEKITDEKAQESQKKEVKGSEAKPKKAKVLEKKS---IEEEKLEDKKE 4453
            ..|......|:.....::.||.|                     ..||.||   ..:|.|.|..:
  Fly   687 GIASTFGELKSRGQRFINLKIVD---------------------PYLETKSSAQAVQETLNDFSK 730

  Fly  4454 KQTE--SAID----EKSQKAEVSEIVSEKITDEKAQESQKEEVKDSEAKPKKAKVLEKKSIEEAK 4512
            :|.:  |:::    ..::|.|| |.:.||:..:..:...|....|::..|               
  Fly   731 RQVDVTSSLENWTTSIAEKREV-EYLLEKVMSDNEETVAKSTQVDTQLYP--------------- 779

  Fly  4513 LEDKKETQTDSAIDEKSQKAEVSEIVSEKITD-EKAQESQKEEV--------KDSEAKPKKAKVL 4568
                  ..|..::|.|.......|.::..|.| |:||:..::.:        ||..:..|..:|:
  Fly   780 ------VFTSQSVDSKQLLISTREKLTNVIQDIERAQDEIQQRIQTTLGIQTKDQPSLAKIEQVI 838

  Fly  4569 EKKSIEEAKLEDKK---ETQTDSAIDEKSQKAEVSEIVSEKITDEKAQESQKEEVKDSEAKPKK- 4629
            ....:.:|||:..|   .|..:|.|.......::                 :.|:.|..|:.:| 
  Fly   839 NNLRMLKAKLDGIKYDYRTLVESVIQFLENIVQL-----------------RREIDDYFARQQKE 886

  Fly  4630 -AKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEVSEIVSEKI------------TDE--KAQE 4679
             |...::...|.||..|:...:..|.|.:       ||::.:::            ||.  |..|
  Fly   887 PASGADRSIAEHEKFRDQCMDKFRSLITQ-------SELLIDRVRVLEPPGAREIDTDRILKLLE 944

  Fly  4680 S-QMEEVKDSEAKPKKAKVLEKKSIEEAKLEDKKETQTDSAIDEKSQKAEVSEIVSEKITDEKAQ 4743
            : ::....:|.|:....:.|||.....:.|||     .|.::|..||  ::.||.::.:      
  Fly   945 NLRLHFESNSSARMSTLERLEKIEQFRSDLED-----IDRSLDSVSQ--QLHEINNQSV------ 996

  Fly  4744 ESQKEEVKDSEAKPKKAKVLEKKSIE--EEKLEDKKEKQTESAIDEK--SQKAEVSEIVSEKITD 4804
                    ||.|..|...:    :.|  |..:|....:|.:|...::  .|.|...|::.::|..
  Fly   997 --------DSLAAAKTTSL----AFEYFERTIECSMPRQLKSTRHQRRWGQTAHTIELLEKRIEK 1049

  Fly  4805 EKAQESQKKEVKGSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEKSQKAEVSEIVSEKITD 4869
            .....||:..:...|::......|.|.:.:.:..:|:.:::.:|.    :|..:..|:| |||  
  Fly  1050 FTESTSQQLFITNPESERYVKDELRKLNEKWQSFKDQVKQKRKSL----NQATDFFEVV-EKI-- 1107

  Fly  4870 EKAQESQKKEVKDSEAKPKKAKVLEKKSIEEEKLEN-------KKEKQTESAIDEKSQKA----E 4923
                :::.:|:..............:.|:|...|.|       .:|....|.:|..||.|    :
  Fly  1108 ----DAEYREISYFYTSVSNKVPYLRDSVEAGNLVNDIENYVTSREAALRSKLDSASQCAHDMNK 1168

  Fly  4924 VSEIVSE---------------KITDEK-AQESQKKEVKDSEAKPKKAKVLEKKSIEEEKLEDKK 4972
            ||.:.::               .:..|: .||.::||.::.:|:.:..:   :|:|:|.:.:::.
  Fly  1169 VSSLYNDVMNIFQSFIKLKMDINVVQERLKQEQRQKEQRERDARDQAER---EKAIKEAEAKERL 1230

  Fly  4973 EKQTESAIDEKFQKAEVSETVSEKITDEKAEESRKEEVKDSEAKPKKAKVLEKKSIEEEKLEDKK 5037
            .::.:|.::.:.|:|.:.:...|....|.|  .|::.|::.||   :.:.:.:::..|:...::.
  Fly  1231 HREEQSRLENQRQQAAIEQAQRELAARELA--LREQAVREEEA---RLQAIREQATREQLAREQA 1290

  Fly  5038 EKQTESAIDEKSQKAEVSETVS-EKITDEKA---QESQKKEVKDSEAKPKKAKILEKKSIEIEKL 5098
            .::.|..|......|...|.|. :.|.||:.   :|.:::..:::|::.|:.:....:..||.:|
  Fly  1291 AREEELRIQSLRDIARREEEVRLQNIRDEETRIRREEEERIRRENESRSKREEEARIQREEITRL 1355

  Fly  5099 DEKKEKQTETKVATDTKSQTVEVSEIVLEKISEEKAEESQKVELKDSEAKSKKAKVLEKKSTLKE 5163
            ...:::..:.::.|:...:.::|:.|..|.   ..|.......|||:.::.....|.|.:.|   
  Fly  1356 QTLRDQVDQQRIVTENIRKDIQVNSIFTEL---RYASPLFTRPLKDAVSREGDRFVFECEVT--- 1414

  Fly  5164 KLDENDKKQKEDG---ATNKSQKAEAADVVPEKISEEKVAEIKTPEPMDSKAKSKPDGLPADEKS 5225
            ...|...:..:||   .||...|......:...:.||..|                    ||...
  Fly  1415 GTPEPAVEWFKDGISIQTNSDYKTTFDKGICRLVIEETFA--------------------ADSAR 1459

  Fly  5226 HGAKVSESVPVKNEAEKTDQLSAKKPTVLDEDLVVPKRKPYLAEQTADSISLQTYKSMDSEYKDR 5290
            ...:.|..|   ...:....||.:: ...:..||.|:...:|                       
  Fly  1460 FSCRASNLV---GTCDTNATLSVRE-NAAEVQLVPPRILRFL----------------------- 1497

  Fly  5291 KESRSAKRKPTVDIQLTNRNTASGSDLKLTCGLSGHEM-NVQWFKDNCPIENGAKYRRTLNDGLS 5354
               :|.|             ...||..:..|.::|..: .|||||::..|::...|..:.|:|.:
  Fly  1498 ---QSGK-------------ATEGSSFQFACVVAGVPLPTVQWFKNDKCIDDSPDYVISYNNGEA 1546

  Fly  5355 CLEIKSAELGDSGIYRCIASNQNGEVETSCLVTIYEAPSSKFGTPPIFTRNIRDAYHSQGNQLTL 5419
            .|:.:...|.|..:|.|.|||..|....|..:.:.....::.   |.|...:.:|....|.::.|
  Fly  1547 TLKFEEVFLEDDAVYTCSASNPAGIEHCSASLIVEPLEPTEL---PSFKVPLSNAMARVGQKIKL 1608

  Fly  5420 ECKVSGSPKPHIYWQRDNTLLPIEGTKYQYEEQSDGIKLLTINNFGSNDSGLYTCYAESENGQMK 5484
            |..|.|.|:|.:||..:........:||:|     |...|.|.....||:|.|...|::..|:  
  Fly  1609 EAIVGGIPRPEVYWLHNGKPFQPRDSKYEY-----GRVTLIIPQAYPNDAGSYVLSAKNLAGE-- 1666

  Fly  5485 ISKFVQASDYVRERIADKKPIDKVIQEIKRDESSSAAANDTAAAKAKAREAKLRLNLETSLKTMT 5549
              .:...:..|:.|:.:             :.|.|..|:|....|..         :...||.::
  Fly  1667 --AYTSCNVIVKGRLPN-------------ETSDSEMASDIEPIKPA---------VHLPLKDVS 1707

  Fly  5550 IGSGNKAQLICYVTGIIE-DVHWLRNDERVTKDARHKIYNINGAISLEIYDARVEDSGHYRCVVK 5613
            |..|...:|.|.:.|..| :|.|..|:..|.:.|..::.......||.|.:...||:|||:.|..
  Fly  1708 IFEGKPVRLDCVIVGQPEPEVIWYHNERPVKESADVQLLFQGDRCSLIIQEVYQEDAGHYKVVAI 1772

  Fly  5614 NSRQTVESAGQLSV--LDQS---------TGKLPE----SFSSGIIESYDDQRNEIVLSCQVIG- 5662
            ||.....|:.:|.|  |:|:         ...||:    .|...:.:...|:..::||..|..| 
  Fly  1773 NSAGEASSSCELKVTPLNQAEPATRAQAERQSLPKDSQPKFERLLSDVLADEGEQVVLEVQASGD 1837

  Fly  5663 RP-SVSWMRDDHSICNNRYRTIEEPG--GVRKLVIRNPISSDCGIFACYAEHEDRIDSTSITIKA 5724
            :| :..|...:..:..::..|.:...  ||.||::.|....|.|::           :..:|..|
  Fly  1838 QPLTAQWFLTNKELQLDQRITTQSDSELGVFKLILNNVSGDDKGVY-----------TVKVTNPA 1891

  Fly  5725 ADLK---RLINVSQEEIPSIGDHESTPWSRSQSHLSSGSQVNGNGELHRAGDRVLRNVGKGKPLF 5786
            .|.|   .||      :.|:...|:...|:|...:.         |.|:.            |.|
  Fly  1892 GDAKCFSHLI------VKSVNAPENRRSSQSSVEII---------ERHQC------------PEF 1929

  Fly  5787 HTLLHDRTVSEGANLRLVCSVSGDENTHIEWLKNHKPLPRSDNRYQTVYLNGEAS-LEIFAAVAD 5850
            ..|..|:.......::..|.|.|.....:.|..|.:|:...:....|   :||.. |.|.....|
  Fly  1930 KELFSDKQGEIDEVIKFECIVKGKPTPKVHWFFNDQPVHGHNFLVST---SGERQVLTIQKLTHD 1991

  Fly  5851 DSGNYTCCATNDFGESLTHAQLRVYKNFKEAPLPS-----------------------TFTQPIR 5892
            ..|..:|.|.|:.|::...|    :.|.:.:.||:                       |||  ..
  Fly  1992 AVGKISCVAENEAGKATCVA----FLNIRGSGLPASSDVQTVSQEHNTESSRVTIKKQTFT--TT 2050

  Fly  5893 DTYSLNENE--------------LVLDCRVRGQPRPEIQWIKGTEPIEASEKFKPSDQADGYAKL 5943
            .|..:|..|              :....:..||.||||     .|.....|..|..:.:      
  Fly  2051 STSQVNSYEGNAPQTEVHHSSAHIDQSLKQLGQQRPEI-----VESHHYQELHKSKEMS------ 2104

  Fly  5944 VIVNPTEKDSGIYWCVARNEGAENKISHQVDFKGRQHYSLEKTHGFFHRDPNKPHFLLPLGNQTV 6008
               :||.:...  :...::.||          .|:...::..:.....|: ..|.|..||..:.|
  Fly  2105 ---SPTVQQKS--FSFIQSSGA----------NGQSAVAIPDSPTRLRRE-IAPRFTTPLSGKIV 2153

  Fly  6009 CNGGTVAISAEFMETSTPIEVKWLRDRRVVDG---PNVKALADRGV---------------YTLT 6055
            ..|..|::.|                  :.||   |.:|...:.|.               .|:.
  Fly  2154 DQGADVSMEA------------------IYDGFPSPEIKVEKNGGQLFEDAHTRISNKCNRVTIE 2200

  Fly  6056 IMNAGPEVEGTYTCRASNAFGRIESNVNVDVAVGAEKDERPPLFLSRPDTEMKIAVGDPFSLSFR 6120
            :...|....|.|...|||..|  :|....|:.|  :|...||:|..|...::. ..|:..::...
  Fly  2201 LKQVGVGDAGRYAVTASNTVG--QSTSTADLVV--KKTIFPPVFGRRLQAQVS-KKGEKLTMEVE 2260

  Fly  6121 IAGDPKPKLTFMKGTKDITQSDRVSKE---VSDDYTRFSVQQAQISDSGTYFVVARNNFGTDRIF 6182
            :.|.|:|.:|::|..|.:..:. :|:.   ...:..|..:::||.:|||.|.|.|.|..|..:  
  Fly  2261 VTGLPEPTVTWLKDDKPLKDAG-ISEHRLLAQGNSYRLIIEKAQTTDSGKYMVRATNAGGEAK-- 2322

  Fly  6183 VTVTVNPRARSATPTQPRWGLPLDSYSDTSYFRDPPGCIS--TEPLVVDSGPTHISLSWGKPVSA 6245
                                    |.:|.:.....|..:.  .:.:|.::||.            
  Fly  2323 ------------------------SIADCAILEPSPERLQEVVKTIVYETGPV------------ 2351

  Fly  6246 NSAPVMAYK--VEAWVVGHEGGAYWR--ELGLTPINSFDAFNLKPNVEYH-------FRVTPKNR 6299
              ||...:|  |:..:...|....::  :..:|..|.....:....:..|       .|:..|:.
  Fly  2352 --APASEFKTEVQKQIQNSENQQSYQNSQTEVTSANDLHGLSESKVITEHRCTTEATMRLEHKSN 2414

  Fly  6300 YGWGPTVQTSSPLQVGGVECLPEFVKILPGQAKALLGSSFTLQCNMRGAPRPQVTWFKDGIQLSS 6364
            |           |.      |||.                        ..||:.....|.|.:::
  Fly  2415 Y-----------LD------LPEL------------------------TTRPKTPTTNDTITITT 2438

  Fly  6365 SSERVKIRQIGST-----------------------CALTIATV---------SELDSGRYTCEA 6397
            ::..|.:.|...|                       |...:||.         ..|.|.||....
  Fly  2439 NTATVSMDQPDLTQPTITNTTTTNTTKVPPPVPPKPCTPVVATTFGQQQQQPPQTLTSTRYEQSE 2503

  Fly  6398 TNSKGRVSTFARLQVVSDSRIY------------------EADSRLKEIAHGRNVADVGDSLPIF 6444
            ..|....|:|...:.:.:..|.                  :|.|..:|:   |::..:....|.|
  Fly  2504 HKSTTSSSSFDYFKKIDEETIIQRPNPLTFKPLDTVVRQPQAQSLAEEL---RSLNLIPGDAPEF 2565

  Fly  6445 -----TMRLRDRRVQVTYPVRLTCQIV--------GYPVPEILWYKDDELIHTDRKHLISAEGQF 6496
                 |.|...:...:|..:::..::.        |.||                          
  Fly  2566 CYSPKTERSEPKIPLITEKIKILSEVQPKEPPPQGGVPV-------------------------- 2604

  Fly  6497 FTLEIAATTLDDSGTYTCLARNELGSVSCHCTLVVDKGIRAYISPDFYVPLDPFYIFREGSEIRL 6561
            |...:...|:....|.|...:.|.|.     .:|....:.|  :|....|..|            
  Fly  2605 FPPPLGLQTVQHESTTTKEVKVEYGQ-----PIVRPAAVLA--TPAQQNPRSP------------ 2650

  Fly  6562 STKVEA--------YPSVGVTWHRNGMRLR-------------PSRRLTA--------------T 6591
            |.|..|        :...|||.:.:.:..:             |::.|.|              |
  Fly  2651 SPKPSAEGVAMSRLWTPTGVTGYTSDVEQKSEKTVISKLATPTPTKELNAPFLVNQIAKSIPPTT 2715

  Fly  6592 LDSNGYVELIIAEATVRDAGIYVCVASNVVGKVETICRVAVEEAENKAVAPQRSLEIPSIKTDDL 6656
            ......|.:.:...|..:    :|.|..|   .||..|..||..|.|  ..|..::.||   ..|
  Fly  2716 APVTHLVNVELEPGTPPE----ICFAPKV---EETRRRSLVETMEQK--LEQNLIQGPS---KVL 2768

  Fly  6657 PYSKEPLFVVKPRSSEAYEGDNVIIFCEVVGDPKPEVVWLRDFLNPEYYKDAPHF--RRIGDGPE 6719
            |:|...|   .|.::...:             |||        |....|:..|..  .|:|   .
  Fly  2769 PHSVPTL---TPNTAAPVQ-------------PKP--------LGNTTYRPPPPVLPTRLG---V 2806

  Fly  6720 YRLEIPSAKLDFTGTYSVIASNCHGEAKAVISLQIFAKDILNKSRMDKVHTRHGNIETLPRFVRN 6784
            |..:..|.:..::|:.|.:......:.      |:...:...||                     
  Fly  2807 YESDYESDRYKYSGSESDVEPGIRKQP------QLTTMETSFKS--------------------- 2844

  Fly  6785 LRNLRCCDGDAISLECHVEADPEPFIIWEKDGHVMPSDRDYVMSFDGTKATLSI----------P 6839
                   .|.....|.|                  .|.|....||..||::.::          |
  Fly  2845 -------SGYTADTEEH------------------SSYRKSESSFYETKSSSTMGGAPQLQTQFP 2884

  Fly  6840 RVYPEDEGEYTCVAKNSVGRSLSSACIIVDVPEEKENMLSRQL-----------------ARPSG 6887
            ::.||........||       ....:...||..:.|:.|::.                 .:.|.
  Fly  2885 KLQPEPPAPIYFTAK-------PQPQVPPQVPPSQSNVSSQEAKGYKYTSSSMTSNYSHNMQSSS 2942

  Fly  6888 LLSAHST----------------PRSTPRSTPARSFSPLRLSYRTSSID--LSGVAERRRSDARN 6934
            ..|.|.|                |....|.|||..||..     :|.||  ...|:....|||. 
  Fly  2943 SSSHHETKFSSTSAPPPVVTYPSPIPAQRKTPAAEFSDY-----SSEIDERFRSVSRANESDAE- 3001

  Fly  6935 AITAPKFLAIPYNRVVEEGDSVRFQCAISGHPTPWATWDKDGLIVTPTPRIAVKEIDDLRIIEID 6999
                    ...|..|.....:.|...|.:||.:|       .:::||:|                
  Fly  3002 --------IKGYRVVFPPTPTPRTNIATNGHKSP-------VVVITPSP---------------- 3035

  Fly  7000 EVTFDDAGLYRVTLENDFGRIEATARLDVIRSSRYSKSPSVRSVRASSSRRNAHLYRRIMGPSTA 7064
             :.|:..       ..|:.|.:.......||....:::.|.:|....:.::|..:::     ...
  Fly  3036 -MEFEPT-------PQDYARPKFEPISKEIRHEIKTETSSKQSKFMQNQQQNQPVFK-----PKP 3087

  Fly  7065 IGGRMALASGYRGSSVPSV----RFYHNDV----------------------ELEASERVHILLQ 7103
            :..:...|:..:....|..    ..|:|.|                      ..|:|:|| :.:|
  Fly  3088 VAAKFIAATQQQQQKQPQATSRPTMYYNAVAGAPMHVAKVATETKNVMQMHESTESSQRV-VNMQ 3151

  Fly  7104 DSMALLIVDNVTREDEGQYTCIISGDHDPLITSTTVTFHDSNTEIRRRRAVITERLP---EITKS 7165
            .:..::..|:...:.:.|..       :|...|...    |.|..|:      ..||   ..||.
  Fly  3152 QTKRIIHFDSPQEQRDQQIL-------EPFPYSPAT----SRTPSRQ------SHLPPPATPTKF 3199

  Fly  7166 LEGEVIDLCCSIECD----EPYSYVWLRNGEILPDSDEFNYIDHGNGRLCL------RINDAFDI 7220
            :.||..:.....|.|    :|   :|...|:.:...........|.||.|.      |:....:.
  Fly  3200 VPGEFRESDYESEIDGARIQP---LWSPYGDGMTKGFRRVAPPQGAGRSCSLPRTYERVLSPMEF 3261

  Fly  7221 DSG----------------------IYSCQVFTSDINDSTS------------------------ 7239
            |.|                      ..:.|..|..:|.:|:                        
  Fly  3262 DRGPEMPSKIHVDINTLRKEQRGGSTVTTQNRTQSLNRNTTMRQQQQQQQQQSMDQIDRAGTLPR 3326

  Fly  7240 -----------------DSTF--DSH------------SICSLINSGCSDCSSSGELCVLERDLR 7273
                             .|||  .||            |..:.|..|.....|.|.   .::...
  Fly  3327 YGYSSLQQQAENQGRRMGSTFLQKSHQFVDDVSREIRSSASNGIRPGFKRAPSEGS---SQQPQA 3388

  Fly  7274 GQDEECVQLLKTPLPVVCASGDEALFYAR---------VFPCD----AEADWYLNGQLLAQADDS 7325
            .:||..|....|.    |...:..|.|.:         :||.:    ..:.|..:|...:.|...
  Fly  3389 FRDESRVSQYGTK----CVDPNTGLIYFKYDFGYEFGILFPGEGHKFVSSQWNSSGSSNSNAKPI 3449

  Fly  7326 LNMTLESYP------------------------ENGI-RLLRMRDVTASR--------------- 7350
            .|.....||                        :|.: |..:.|:.:.::               
  Fly  3450 QNGRHSPYPLKLPPGNELVIPVQHERSAQGYSSDNEVQRRSQTRNWSTTKPMAPRTINSHKRYSL 3514

  Fly  7351 -SG---EICLQVKHPQAEFRRIPTTRTYTSLLVLP---AIRGNSSSSSLAARSCILTRP-EDCTA 7407
             ||   :|.|...|.||.  |:|..:...::..||   .:..:.|...||.|..:...| :|...
  Fly  3515 PSGHSLDIHLDRLHAQAP--RLPPDQMIRTVPELPNTEPVNAHLSRDELAQRQPLFITPLKDIAV 3577

  Fly  7408 LIGGHVRLSVRYEPFPGTKVIW----------YKACHPIVESSNVTIRTTSQQSTLYITDISADD 7462
            .:||..|.....:..|..:|.|          .:.|   :|..|...|.|..|:       ..||
  Fly  3578 GVGGTARFECIVQAHPQPQVNWTHNGGLLESGSRHC---IEYRNGVCRLTLPQA-------YPDD 3632

  Fly  7463 SGKYTVEVMNDYGVEAAAASVAV 7485
            :|.|....:|..|....:.::.|
  Fly  3633 NGSYACTAINPLGAATTSGNLTV 3655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412 155/887 (17%)
PTZ00121 <4215..5072 CDD:173412 178/944 (19%)
I-set 5300..5388 CDD:400151 23/88 (26%)
Ig strand B 5317..5321 CDD:409353 0/3 (0%)
Ig strand C 5329..5333 CDD:409353 2/3 (67%)
Ig strand E 5354..5358 CDD:409353 1/3 (33%)
Ig strand F 5368..5373 CDD:409353 2/4 (50%)
Ig_3 5399..5477 CDD:464046 22/77 (29%)
Ig 5542..5627 CDD:472250 26/85 (31%)
Ig strand B 5556..5560 CDD:409353 1/3 (33%)
Ig strand C 5568..5572 CDD:409353 1/3 (33%)
Ig strand E 5593..5597 CDD:409353 2/3 (67%)
Ig strand F 5607..5612 CDD:409353 2/4 (50%)
Ig 5654..5721 CDD:409353 14/70 (20%)
Ig strand B 5654..5658 CDD:409353 2/3 (67%)
Ig strand C 5665..5669 CDD:409353 0/3 (0%)
Ig strand E 5690..5694 CDD:409353 2/3 (67%)
Ig strand F 5704..5709 CDD:409353 0/4 (0%)
Ig strand G 5718..5721 CDD:409353 0/2 (0%)
I-set 5784..5874 CDD:400151 22/90 (24%)
Ig strand B 5801..5805 CDD:409353 0/3 (0%)
Ig strand C 5814..5818 CDD:409353 0/3 (0%)
Ig strand E 5840..5844 CDD:409353 1/4 (25%)
Ig strand F 5854..5859 CDD:409353 1/4 (25%)
Ig 5902..5963 CDD:409353 11/60 (18%)
Ig strand B 5902..5906 CDD:409353 0/3 (0%)
Ig strand C 5915..5919 CDD:409353 2/3 (67%)
Ig strand E 5941..5945 CDD:409353 0/3 (0%)
Ig strand F 5955..5960 CDD:409353 0/4 (0%)
Ig 5997..6086 CDD:472250 22/106 (21%)
Ig strand B 6014..6018 CDD:409353 1/3 (33%)
Ig strand C 6028..6032 CDD:409353 0/3 (0%)
Ig strand E 6050..6056 CDD:409353 2/20 (10%)
Ig strand F 6066..6071 CDD:409353 1/4 (25%)
Ig strand G 6079..6082 CDD:409353 1/2 (50%)
Ig 6107..6187 CDD:472250 19/82 (23%)
Ig strand B 6115..6119 CDD:409353 0/3 (0%)
Ig strand C 6128..6132 CDD:409353 1/3 (33%)
Ig strand E 6153..6157 CDD:409353 1/3 (33%)
Ig strand F 6167..6172 CDD:409353 2/4 (50%)
Ig strand G 6180..6183 CDD:409353 0/2 (0%)
FN3 6216..6310 CDD:238020 15/106 (14%)
I-set 6321..6412 CDD:400151 19/122 (16%)
Ig strand B 6339..6343 CDD:409353 0/3 (0%)
Ig strand C 6352..6356 CDD:409353 0/3 (0%)
Ig strand E 6375..6382 CDD:409353 2/29 (7%)
Ig strand F 6392..6397 CDD:409353 2/4 (50%)
Ig strand G 6405..6408 CDD:409353 1/2 (50%)
I-set 6442..6531 CDD:400151 14/101 (14%)
Ig strand B 6459..6463 CDD:409353 0/3 (0%)
Ig strand C 6472..6476 CDD:409353 0/3 (0%)
Ig strand E 6497..6501 CDD:409353 1/3 (33%)
Ig strand F 6511..6516 CDD:409353 2/4 (50%)
Ig strand G 6524..6527 CDD:409353 0/2 (0%)
Ig 6541..6632 CDD:472250 21/125 (17%)
Ig strand B 6559..6563 CDD:409353 0/3 (0%)
Ig strand C 6572..6576 CDD:409353 3/3 (100%)
Ig strand E 6598..6602 CDD:409353 1/3 (33%)
Ig strand F 6612..6617 CDD:409353 1/4 (25%)
Ig strand G 6625..6628 CDD:409353 2/2 (100%)
Ig 6662..6754 CDD:472250 14/93 (15%)
Ig strand B 6679..6683 CDD:409353 0/3 (0%)
Ig strand C 6692..6696 CDD:409353 0/3 (0%)
Ig strand E 6720..6724 CDD:409353 1/3 (33%)
Ig strand F 6734..6739 CDD:409353 1/4 (25%)
I-set 6779..6868 CDD:400151 14/98 (14%)
Ig strand B 6796..6800 CDD:409353 0/3 (0%)
Ig strand C 6809..6813 CDD:409353 0/3 (0%)
Ig strand E 6834..6838 CDD:409353 0/3 (0%)
Ig strand F 6848..6853 CDD:409353 0/4 (0%)
I-set 6939..7028 CDD:400151 13/88 (15%)
Ig strand B 6956..6960 CDD:409353 1/3 (33%)
Ig strand C 6969..6973 CDD:409353 0/3 (0%)
Ig strand E 6993..6998 CDD:409353 0/4 (0%)
Ig strand F 7008..7013 CDD:409353 0/4 (0%)
Ig strand G 7021..7024 CDD:409353 0/2 (0%)
IG_like 7075..7140 CDD:214653 13/90 (14%)
Ig strand C 7082..7086 CDD:409353 0/7 (0%)
Ig strand E 7107..7111 CDD:409353 0/3 (0%)
Ig strand F 7121..7126 CDD:409353 1/4 (25%)
Ig strand G 7135..7138 CDD:409353 1/2 (50%)
Ig 7173..7232 CDD:409353 13/90 (14%)
Ig strand C 7184..7188 CDD:409353 0/3 (0%)
Ig strand E 7210..7214 CDD:409353 1/9 (11%)
Ig strand F 7224..7229 CDD:409353 0/4 (0%)
IG_like 7406..7475 CDD:214653 17/78 (22%)
Ig strand B 7413..7417 CDD:409353 1/3 (33%)
Ig strand C 7426..7430 CDD:409353 2/13 (15%)
Ig strand E 7451..7455 CDD:409353 0/3 (0%)
Ig strand F 7465..7470 CDD:409353 1/4 (25%)
FN3 7489..7588 CDD:238020
STKc_MLCK 7626..7876 CDD:271005
zorminNP_001261317.1 SPEC 126..332 CDD:238103 34/205 (17%)
SPEC <504..641 CDD:413338 29/146 (20%)
SMC_prok_B 654..>1389 CDD:274008 158/865 (18%)
Smc <1192..>1377 CDD:440809 35/192 (18%)
I-set 1390..1479 CDD:400151 20/114 (18%)
Ig strand B 1407..1411 CDD:409564 1/3 (33%)
Ig strand C 1420..1424 CDD:409564 0/3 (0%)
Ig strand E 1445..1449 CDD:409564 0/3 (0%)
Ig strand F 1459..1464 CDD:409564 0/4 (0%)
Ig strand G 1472..1475 CDD:409564 0/2 (0%)
I-set 1491..1580 CDD:400151 27/127 (21%)
Ig strand B 1508..1512 CDD:409353 0/3 (0%)
Ig strand C 1521..1525 CDD:409353 2/3 (67%)
Ig strand E 1546..1550 CDD:409353 1/3 (33%)
Ig strand F 1560..1565 CDD:409353 2/4 (50%)
Ig strand G 1573..1576 CDD:409353 0/2 (0%)
I-set 1589..1675 CDD:400151 24/94 (26%)
Ig strand B 1606..1610 CDD:409353 1/3 (33%)
Ig strand C 1619..1623 CDD:409353 1/3 (33%)
Ig strand E 1641..1645 CDD:409353 1/3 (33%)
Ig strand F 1655..1660 CDD:409353 1/4 (25%)
Ig strand G 1668..1671 CDD:409353 0/2 (0%)
I-set 1702..1786 CDD:400151 26/83 (31%)
Ig strand B 1714..1718 CDD:409353 1/3 (33%)
Ig strand C 1727..1731 CDD:409353 1/3 (33%)
Ig strand E 1752..1756 CDD:409353 2/3 (67%)
Ig strand F 1766..1771 CDD:409353 2/4 (50%)
Ig strand G 1779..1782 CDD:409353 1/2 (50%)
I-set 1811..1902 CDD:400151 22/107 (21%)
Ig strand B 1828..1832 CDD:409353 2/3 (67%)
Ig strand C 1841..1845 CDD:409353 0/3 (0%)
Ig strand E 1868..1872 CDD:409353 2/3 (67%)
Ig strand F 1882..1887 CDD:409353 0/15 (0%)
I-set 1927..2015 CDD:400151 22/94 (23%)
Ig strand B 1944..1948 CDD:409353 0/3 (0%)
Ig strand C 1957..1961 CDD:409353 0/3 (0%)
Ig strand E 1981..1985 CDD:409353 1/3 (33%)
Ig strand F 1995..2000 CDD:409353 1/4 (25%)
Ig strand G 2008..2011 CDD:409353 0/2 (0%)
Ig 2142..2231 CDD:472250 23/108 (21%)
Ig strand B 2159..2163 CDD:409353 1/3 (33%)
Ig strand C 2172..2176 CDD:409353 1/3 (33%)
Ig strand E 2197..2201 CDD:409353 1/3 (33%)
Ig strand F 2211..2216 CDD:409353 1/4 (25%)
Ig strand G 2224..2227 CDD:409353 0/2 (0%)
I-set 2238..2325 CDD:400151 23/114 (20%)
Ig strand B 2255..2259 CDD:409353 0/3 (0%)
Ig strand C 2268..2272 CDD:409353 1/3 (33%)
Ig strand F 2309..2314 CDD:409353 2/4 (50%)
PHA03247 <2593..2893 CDD:223021 71/435 (16%)
I-set 3566..3655 CDD:400151 20/98 (20%)
Ig strand B 3583..3587 CDD:409353 1/3 (33%)
Ig strand C 3596..3600 CDD:409353 1/3 (33%)
Ig strand E 3621..3625 CDD:409353 1/3 (33%)
Ig strand F 3635..3640 CDD:409353 1/4 (25%)
Ig strand G 3648..3651 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.