DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and PALLD

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:XP_011530070.1 Gene:PALLD / 23022 HGNCID:17068 Length:1468 Species:Homo sapiens


Alignment Length:1756 Identity:360/1756 - (20%)
Similarity:584/1756 - (33%) Gaps:531/1756 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  5041 TESAIDEKSQKAEVSETVSEKITDEKAQESQKKEVKDSEAKPKKAKILEKKSIEIEKLDEKKEKQ 5105
            |||.......::.:|.|.|.:...:...:.| :|.|:::..|..:..|.::.|. :.||..:...
Human    56 TESRHRVHEDRSNMSGTSSHESFYDSLSDMQ-EESKNTDFFPGLSAFLSQEEIN-KSLDLARRAI 118

  Fly  5106 TETKVATDTKSQTVEVSEIVLEKISEEKAEESQKVELKDSEAKSKKAKVLEKKSTLKEKLDENDK 5170
            .:::  |:......|:|:|.                      .:..|.:.|..|..:.||.|:..
Human   119 ADSE--TEDFDSEKEISQIF----------------------STSPASLCEHPSHKETKLGEHAS 159

  Fly  5171 KQKEDGATNKSQKAEAADVVPEKISEEKVAEIKTP----EPMDSKAKSKPDGLPADEKS--HGAK 5229
            ::.:|   |:|...       :.::|::...|.:|    :|..|...::|..:.:..|:  .|||
Human   160 RRPQD---NRSTPV-------QPLAEKQTKSISSPVSKRKPAMSPLLTRPSYIRSLRKAEKRGAK 214

  Fly  5230 -----VSESVPVKNEAEKTDQLSAKKPTVLDE-DLVVPKRKPYLAEQTADSISLQTYKSMDSEYK 5288
                 |....|.:.:.....||..|...:::| ..:....||.......:|      .|.||.| 
Human   215 TPSTNVKPKTPHQRKGGPQSQLCDKAANLIEELTSIFKAAKPRNRSPNGES------SSPDSGY- 272

  Fly  5289 DRKESRSAKRKPTVDIQLTNRNTASGSDLKLTCGLSGHEMNVQWFKDNCPIENGAKYRRTLNDGL 5353
                 .|.|.:|:..:      :||.|                    ..|:|:..:..|      
Human   273 -----LSPKNQPSALL------SASAS--------------------QSPMEDQGEMER------ 300

  Fly  5354 SCLEIKSAELGDSGIYRCIASNQNGEVETSCLVTIYEAPSS--KFGTPPIFTRNIRDAYHSQGNQ 5416
               |:||     .|...|...||:..|..:  ...:..|.|  .|...|.|.:.:|....::|::
Human   301 ---EVKS-----PGARHCYQDNQDLAVPHN--RKSHPQPHSALHFPAAPRFIQKLRSQEVAEGSR 355

  Fly  5417 LTLECKVSGSPKPHIYW-----QRDNTLLPIEGTKYQYEEQSDGIKLLTINNFGSNDSGLYTCYA 5476
            :.|||:|:|:|.|.:.|     :..||      ...|...:...:..|.|.....:|:|.|||.|
Human   356 VYLECRVTGNPTPRVRWFCEGKELHNT------PDIQIHCEGGDLHTLIIAEAFEDDTGRYTCLA 414

  Fly  5477 ESENGQMKISKFVQASDYVRERIADKKPIDKVIQEIKRDESSSAAANDTAAAKAKAREAKL-RLN 5540
            .:.:|    |....|..::                    |.:|:..:|:.:...|:|...: :..
Human   415 TNPSG----SDTTSAEVFI--------------------EGASSTDSDSESLAFKSRAGAMPQAQ 455

  Fly  5541 LETSLKTMTIGSGNKAQLICYVTGIIEDVHWLRNDERVTKDARHKIYNINGAISLEIYDARVEDS 5605
            .:|:..::||||.:....:  .|.:|:                          .|.:...:|...
Human   456 KKTTSVSLTIGSSSPKTGV--TTAVIQ--------------------------PLSVPVQQVHSP 492

  Fly  5606 GHYRCVVKNSRQTVESAGQLSVLDQSTGKLPESFSSGIIESYDDQRNEIVLSCQVIGRP--SVSW 5668
            ..|.|....:               :|...|..|:..:..:...:...:||.|:|.|.|  .|.|
Human   493 TSYLCRPDGT---------------TTAYFPPVFTKELQNTAVAEGQVVVLECRVRGAPPLQVQW 542

  Fly  5669 MRD--------DHSICNNRYRTIEEPGGVRKLVIRNPISSDCGIFACYAEHE--DRIDSTSITIK 5723
            .|.        |..|...:.|:..||..:..|||......|.|||.|.|.::  ....:..:.:.
Human   543 FRQGSEIQDSPDFRILQKKPRSTAEPEEICTLVIAETFPEDAGIFTCSARNDYGSATSTAQLVVT 607

  Fly  5724 AADLKRLINVSQEEI-PSIGDH-----------ESTPWSRSQSHLSSGSQVNGNGELHRAGDRVL 5776
            :|:.:   |.|.|.: .|..||           |::....:....|...||| |.||        
Human   608 SANTE---NCSYESMGESNNDHFQHFPPPPPILETSSLELASKKPSEIQQVN-NPEL-------- 660

  Fly  5777 RNVGKGKPLFHTLLHDRTVSEGANLRLVCSVSGDENTHIEWLKNHKPLPRSDNRYQTVYLNGEAS 5841
               |..:               |.|::..:.:..|...:.           .:|.....:||:|:
Human   661 ---GLSR---------------AALQMQFNAAERETNGVH-----------PSRGVNGLINGKAN 696

  Fly  5842 LEIFAAVADDSGNYTCCATNDFGESLTHAQLRVYKNFKEAPLPSTFTQPIRDTYSL--------- 5897
                                               :.|..|.|:....|.::...|         
Human   697 -----------------------------------SNKSLPTPAVLLSPTKEPPPLLAKPKLDPL 726

  Fly  5898 ------NENELVLDCRVRGQPR-----------------PEIQWI---KGTEPIEA-SEKFKPSD 5935
                  |:..|..:...|..|.                 ||:...   ...||:.| :.:..|:.
Human   727 KLQQLQNQIRLEQEAGARQPPPAPRSAPPSPPFPPPPAFPELAACTPPASPEPMSALASRSAPAM 791

  Fly  5936 QADG---YAKLVIVNPTEKDSGIYWCVARNEGAENKISHQVDFKGRQHYSL----EKTHGFFHRD 5993
            |:.|   ||:     |.:      :..|:|.|..:  .|..........||    ..|...|.|.
Human   792 QSSGSFNYAR-----PKQ------FIAAQNLGPAS--GHGTPASSPSSSSLPSPMSPTPRQFGRA 843

  Fly  5994 PNKPHFLLPLGNQTVCNGGTVAISAE------FMETST-PIEVKWLRDRRVVDGPNV-------K 6044
            | .|.|..|.|.:.....|:.:.|..      |..|:. |:             |:|       .
Human   844 P-VPPFAQPFGAEPEAPWGSSSPSPPPPPPPVFSPTAAFPV-------------PDVFPLPPPPP 894

  Fly  6045 ALADRGVYTLTIMNAGPEVEGTYTCRASNAFGRIESNVNVDVAVGAEKDERPPLFL-----SRPD 6104
            .|...|             :.::....:..||.               .:.|..||     |:|.
Human   895 PLPSPG-------------QASHCSSPATRFGH---------------SQTPAAFLSALLPSQPP 931

  Fly  6105 TEMKIAVGDP-----------FSLSFRIAGDPKPKLTFMKGTKDITQSDRVSKEVSDDYTRFSVQ 6158
            .....|:|.|           .|.:.|||.|.:     ::||||....|...|      .||   
Human   932 PAAVNALGLPKGVTPAGFPKKASRTARIASDEE-----IQGTKDAVIQDLERK------LRF--- 982

  Fly  6159 QAQISDSG----TYFV-VARNNFGTDRIFVTVTVNPRARSATPTQPRWGLPLDSYSDTSYFRDPP 6218
            :..:.::|    ||.. :||...|.|...|.....|...:|..                      
Human   983 KEDLLNNGQPRLTYEERMARRLLGADSATVFNIQEPEEETANQ---------------------- 1025

  Fly  6219 GCISTEPLVVDSGPTHISLSWGKPVSANSAPVMAYKVEAWVVGHEGGAYWRELGLTPINSFDAFN 6283
                      |.|..|.|:  |.|:....    .|||                      |.....
Human  1026 ----------DIGSPHASV--GSPLDGQK----EYKV----------------------SSCEQR 1052

  Fly  6284 LKPNVEYHFRVTPKNRYGWGPTVQTSSPLQVGGVEC---LPEFVKILPGQAKALLGSSFTLQCNM 6345
            |...:||....:|.:..|        ..:|.|.|..   :..|.::.....|...|...|..|.:
Human  1053 LISEIEYRLERSPVDESG--------DEVQYGDVPVENGMAPFFEMKLKHYKIFEGMPVTFTCRV 1109

  Fly  6346 RGAPRPQVTWFKDGIQLSSSSERVKI-RQIGSTCAL--TIATVSELDSGRYTCEATNSKGRVSTF 6407
            .|.|:|::.|||||.|:|..|:...| |.:..||:|  |.:|:.  |.|.||..|.|.:||:|..
Human  1110 AGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLD--DDGNYTIMAANPQGRISCT 1172

  Fly  6408 ARLQVVS---DSRIYEADSRLKEIAHGRNVA-DVGDS---------LPIFTMRLRDRRVQVTYPV 6459
            .||.|.:   ..|...:.|....:...|:.: |.||.         .|.|.....|..||.....
Human  1173 GRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLC 1237

  Fly  6460 RLTCQIVGYPVPEILWYKDDELIHTDRKH-LISAEGQFFTLEIAATTLDDSGTYTCLARNELGSV 6523
            |:.|::.|.|.|::.|..|.:.:..|..| ::..|....:|.|...|..|:|.|||:|.|..|..
Human  1238 RMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQN 1302

  Fly  6524 SCHCTLVVDKGIRAYISPDFYVPLDPFYIFREGSEIRLSTKVEAYPSVGVTWHRNGMRLRPSR-R 6587
            |....||| ....|:..|.|...|....: .:|..:||..:|...|...:.|.:....|..|. |
Human  1303 SFSLELVV-AAKEAHKPPVFIEKLQNTGV-ADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDR 1365

  Fly  6588 LTATLDSNGYVELIIAEATVRDAGIYVCVASNVVGKVETICRVAV--------EEAENKAVAPQR 6644
            ::...|::||:.|:|..||..|||.|...|.|..|.|....|:.|        :..:.|.|.|..
Human  1366 VSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSA 1430

  Fly  6645 S 6645
            |
Human  1431 S 1431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412
PTZ00121 <4215..5072 CDD:173412 6/30 (20%)
I-set 5300..5388 CDD:400151 15/87 (17%)
Ig strand B 5317..5321 CDD:409353 0/3 (0%)
Ig strand C 5329..5333 CDD:409353 0/3 (0%)
Ig strand E 5354..5358 CDD:409353 0/3 (0%)
Ig strand F 5368..5373 CDD:409353 1/4 (25%)
Ig_3 5399..5477 CDD:464046 22/82 (27%)
Ig 5542..5627 CDD:472250 11/84 (13%)
Ig strand B 5556..5560 CDD:409353 0/3 (0%)
Ig strand C 5568..5572 CDD:409353 0/3 (0%)
Ig strand E 5593..5597 CDD:409353 1/3 (33%)
Ig strand F 5607..5612 CDD:409353 2/4 (50%)
Ig 5654..5721 CDD:409353 23/78 (29%)
Ig strand B 5654..5658 CDD:409353 2/3 (67%)
Ig strand C 5665..5669 CDD:409353 1/3 (33%)
Ig strand E 5690..5694 CDD:409353 1/3 (33%)
Ig strand F 5704..5709 CDD:409353 3/4 (75%)
Ig strand G 5718..5721 CDD:409353 0/2 (0%)
I-set 5784..5874 CDD:400151 7/89 (8%)
Ig strand B 5801..5805 CDD:409353 1/3 (33%)
Ig strand C 5814..5818 CDD:409353 0/3 (0%)
Ig strand E 5840..5844 CDD:409353 1/3 (33%)
Ig strand F 5854..5859 CDD:409353 0/4 (0%)
Ig 5902..5963 CDD:409353 15/84 (18%)
Ig strand B 5902..5906 CDD:409353 1/3 (33%)
Ig strand C 5915..5919 CDD:409353 1/3 (33%)
Ig strand E 5941..5945 CDD:409353 1/3 (33%)
Ig strand F 5955..5960 CDD:409353 0/4 (0%)
Ig 5997..6086 CDD:472250 15/102 (15%)
Ig strand B 6014..6018 CDD:409353 0/3 (0%)
Ig strand C 6028..6032 CDD:409353 0/3 (0%)
Ig strand E 6050..6056 CDD:409353 1/5 (20%)
Ig strand F 6066..6071 CDD:409353 0/4 (0%)
Ig strand G 6079..6082 CDD:409353 0/2 (0%)
Ig 6107..6187 CDD:472250 24/95 (25%)
Ig strand B 6115..6119 CDD:409353 1/3 (33%)
Ig strand C 6128..6132 CDD:409353 0/3 (0%)
Ig strand E 6153..6157 CDD:409353 2/3 (67%)
Ig strand F 6167..6172 CDD:409353 2/5 (40%)
Ig strand G 6180..6183 CDD:409353 0/2 (0%)
FN3 6216..6310 CDD:238020 15/93 (16%)
I-set 6321..6412 CDD:400151 34/93 (37%)
Ig strand B 6339..6343 CDD:409353 1/3 (33%)
Ig strand C 6352..6356 CDD:409353 0/3 (0%)
Ig strand E 6375..6382 CDD:409353 3/8 (38%)
Ig strand F 6392..6397 CDD:409353 2/4 (50%)
Ig strand G 6405..6408 CDD:409353 1/2 (50%)
I-set 6442..6531 CDD:400151 28/89 (31%)
Ig strand B 6459..6463 CDD:409353 1/3 (33%)
Ig strand C 6472..6476 CDD:409353 0/3 (0%)
Ig strand E 6497..6501 CDD:409353 1/3 (33%)
Ig strand F 6511..6516 CDD:409353 3/4 (75%)
Ig strand G 6524..6527 CDD:409353 1/2 (50%)
Ig 6541..6632 CDD:472250 28/91 (31%)
Ig strand B 6559..6563 CDD:409353 2/3 (67%)
Ig strand C 6572..6576 CDD:409353 0/3 (0%)
Ig strand E 6598..6602 CDD:409353 1/3 (33%)
Ig strand F 6612..6617 CDD:409353 1/4 (25%)
Ig strand G 6625..6628 CDD:409353 0/2 (0%)
Ig 6662..6754 CDD:472250
Ig strand B 6679..6683 CDD:409353
Ig strand C 6692..6696 CDD:409353
Ig strand E 6720..6724 CDD:409353
Ig strand F 6734..6739 CDD:409353
I-set 6779..6868 CDD:400151
Ig strand B 6796..6800 CDD:409353
Ig strand C 6809..6813 CDD:409353
Ig strand E 6834..6838 CDD:409353
Ig strand F 6848..6853 CDD:409353
I-set 6939..7028 CDD:400151
Ig strand B 6956..6960 CDD:409353
Ig strand C 6969..6973 CDD:409353
Ig strand E 6993..6998 CDD:409353
Ig strand F 7008..7013 CDD:409353
Ig strand G 7021..7024 CDD:409353
IG_like 7075..7140 CDD:214653
Ig strand C 7082..7086 CDD:409353
Ig strand E 7107..7111 CDD:409353
Ig strand F 7121..7126 CDD:409353
Ig strand G 7135..7138 CDD:409353
Ig 7173..7232 CDD:409353
Ig strand C 7184..7188 CDD:409353
Ig strand E 7210..7214 CDD:409353
Ig strand F 7224..7229 CDD:409353
IG_like 7406..7475 CDD:214653
Ig strand B 7413..7417 CDD:409353
Ig strand C 7426..7430 CDD:409353
Ig strand E 7451..7455 CDD:409353
Ig strand F 7465..7470 CDD:409353
FN3 7489..7588 CDD:238020
STKc_MLCK 7626..7876 CDD:271005
PALLDXP_011530070.1 IgI_2_Titin_Z1z2-like 338..429 CDD:409564 26/100 (26%)
Ig strand A 338..341 CDD:409564 1/2 (50%)
Ig strand A' 344..348 CDD:409564 1/3 (33%)
Ig strand B 356..364 CDD:409564 4/7 (57%)
Ig strand C 369..374 CDD:409564 1/4 (25%)
Ig strand C' 377..379 CDD:409564 0/1 (0%)
Ig strand D 385..390 CDD:409564 1/4 (25%)
Ig strand E 394..399 CDD:409564 1/4 (25%)
Ig strand F 408..416 CDD:409564 5/7 (71%)
Ig strand G 419..429 CDD:409564 3/13 (23%)
Ig 508..606 CDD:472250 25/97 (26%)
Ig strand B 526..530 CDD:409564 2/3 (67%)
Ig strand C 539..543 CDD:409564 1/3 (33%)
Ig strand E 572..576 CDD:409564 1/3 (33%)
Ig strand F 586..591 CDD:409564 3/4 (75%)
Ig strand G 599..602 CDD:409564 0/2 (0%)
IgI_1_Palladin_C 1086..1177 CDD:409474 34/92 (37%)
Ig strand A 1086..1089 CDD:409474 1/2 (50%)
Ig strand A' 1092..1097 CDD:409474 0/4 (0%)
Ig strand B 1102..1109 CDD:409474 2/6 (33%)
Ig strand C 1116..1122 CDD:409474 2/5 (40%)
Ig strand C' 1123..1126 CDD:409474 1/2 (50%)
Ig strand D 1133..1139 CDD:409474 2/5 (40%)
Ig strand E 1142..1152 CDD:409474 4/9 (44%)
Ig strand F 1156..1164 CDD:409474 4/7 (57%)
Ig strand G 1166..1177 CDD:409474 5/10 (50%)
Ig 1220..1310 CDD:472250 28/89 (31%)
Ig strand B 1237..1241 CDD:409353 1/3 (33%)
Ig strand C 1250..1254 CDD:409353 0/3 (0%)
Ig strand E 1276..1280 CDD:409353 1/3 (33%)
Ig strand F 1290..1295 CDD:409353 3/4 (75%)
Ig strand G 1303..1306 CDD:409353 1/2 (50%)
IgI_Myotilin_C 1319..1410 CDD:409473 28/91 (31%)
Ig strand A 1319..1322 CDD:409473 1/2 (50%)
Ig strand A' 1325..1330 CDD:409473 1/4 (25%)
Ig strand B 1335..1342 CDD:409473 2/6 (33%)
Ig strand C 1349..1355 CDD:409473 1/5 (20%)
Ig strand C' 1356..1359 CDD:409473 0/2 (0%)
Ig strand D 1366..1372 CDD:409473 0/5 (0%)
Ig strand E 1375..1385 CDD:409473 4/9 (44%)
Ig strand F 1389..1397 CDD:409473 3/7 (43%)
Ig strand G 1399..1410 CDD:409473 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.