DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and Ttn

DIOPT Version :9

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:NP_001372637.1 Gene:Ttn / 22138 MGIID:98864 Length:35463 Species:Mus musculus


Alignment Length:9888 Identity:2038/9888 - (20%)
Similarity:3467/9888 - (35%) Gaps:2933/9888 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RPPPRITFSENSSSLIRCIPNERATFFVKIDCSEEDEPELLPFKFEWSRGEIPIENSDRFRITAT 88
            |.|.:..|.:.....|..|..|.|.|...:..::       |.:..||:....|.....:.||..
Mouse  7278 REPKKSPFFDIKPVSIDVIAGESADFECHVTGAQ-------PMRVTWSKDNKEIRPGGNYTITCV 7335

  Fly    89 SNAVQLAVEHVQREDAGHYTLFARTKRQDVVRR--HVELIVEDRSTGDDPPVFVRRLPDLSV-KV 150
            .|...|.:..|.:.|:|.||..|   ..||.:.  ..:|.|:      :||.|:::|....| |.
Mouse  7336 GNTPHLRILKVGKGDSGQYTCQA---TNDVGKDMCSAQLSVK------EPPKFIKKLDASKVAKQ 7391

  Fly   151 GTRTRLLTEIRSSTDLKLTWYRNDRRVCANDRITEVNEGTFHY----------LEISPVTLDDGG 205
            |...:|..:|..|.::|:.|:|||         :|::| ::.|          |.|:..:.:|.|
Mouse  7392 GESIQLECKISGSPEIKVVWFRND---------SELHE-SWKYNMSFVNSVALLTINEASAEDTG 7446

  Fly   206 QWMLMAENFGGRNSCLGTLNVLVPKAYKTPEFVEELRAVLTEQGT-VSLECKVVGVPTPHLRWFK 269
            .::..|.|..|..||...|.|..|     |.|.::...|...:|: |.|:|::.|.|...:.|.|
Mouse  7447 DYICEAHNGVGDASCSTALKVKAP-----PVFTQKPPPVGALKGSDVILQCEISGTPPFEVVWVK 7506

  Fly   270 DSKEIKAGDIFALTA----------NADDPTSLGTYTCEARNCMGVTYSSSKVHVVGRGSREGSL 324
            |.|::::...|.:|:          |.:.| .:|.|.|:|.|.:|                    
Mouse  7507 DRKQVRSSKKFKITSKNFDTSLHIFNLEAP-DIGEYHCKATNEVG-------------------- 7550

  Fly   325 KPADSVASNA---PPPIFTNELRDMSLLIGETIILGCQVVVPPW-PKSVCWYNASGRV--ETAE- 382
              :|:.|...   .||.|..:|.|.|.|||:.:.|  |.||..: |.||.|....|.|  |:.. 
Mouse  7551 --SDTCACTVKFKEPPRFVKKLSDASTLIGDPVEL--QAVVEGFQPISVVWLKDKGEVIRESENV 7611

  Fly   383 RYKLIEDGLGVYMIEVKPSESCDAGEWKCVVTSFDGSMGISTCSVAMDI--PRN-YRKPRFMESL 444
            |...:::   :..:::...|:..:|::.|.:.:   ..|:..||..:.:  |.. ..||..|   
Mouse  7612 RISFVDN---IATLQLGSPEASQSGKYVCQIKN---DAGMRECSAVLTVLEPATIVEKPEPM--- 7667

  Fly   445 RAVLTEEGLVSFECKVVGFPTPVLKWFKDGHELKPGDVYQLTGTNSL------------------ 491
              .:|.....:.||.|.|.|....||||||.||..|..:.:|...:|                  
Mouse  7668 --TVTTGNPFTLECVVAGTPELSAKWFKDGRELSSGSRHHITFVRNLASLKIPSAEMNDKGLYTF 7730

  Fly   492 ----------------------------------------------------------------- 491
                                                                             
Mouse  7731 EVENRVGKSSCTVSVHVSDRVVPPSFVRRLKDTSATLGASVVLECRVSGSAPISVGWFLDGNEII 7795

  Fly   492 --------------------------GTYCCIARNCMGETSSTAVLTV----------------- 513
                                      |.|.|:|.|..|:..|:|||||                 
Mouse  7796 SSPKCQSSFADNVCTLTLSSLEPSDTGAYTCVAANVAGQDESSAVLTVQEPPSFEQTPDSVEVLP 7860

  Fly   514 -------------------------------------EDIQNQLT----------DEERLVFNQQ 531
                                                 ||...:|.          |...||.|..
Mouse  7861 GMSLTFTSVIRGTPPFKVKWFKGSRELVSGEACTISLEDFVTELELLEVEPGQSGDYSCLVTNDA 7925

  Fly   532 NQ---------NQAPKFLIGLKSTDAKINEPFQFKVVVKATPNPILSWFRDELPIDPNERYNHYR 587
            ..         .:...|:..|..|..:...|...:.....||...:||.::|.|:..:.......
Mouse  7926 GSASCTTHLFVKEPATFVKRLADTSVETGSPIVLEATYSGTPPISVSWMKNEYPLSQSPNCGITT 7990

  Fly   588 GENEDWLLDIKSVEFVDQAEWKCVAVNDFGTSITSCFLKLQIPRHYKKPRFLECLRAVLTEEGAV 652
            .|... :|:|......|.|::.|:..|:.|..|....:.:..|.::.:|  ||.:.|.:.|  .:
Mouse  7991 TEKSS-ILEILESTIEDYAQYACLIENEAGQDICEALVSVLEPPYFIEP--LEHVEAAIGE--PI 8050

  Fly   653 NLECKVIGVPQPALKWYKDGVELKPGDIHR----------IISGQDGTCCLGTYTCEAKNCMGIV 707
            .|:|||.|.|:..:.|||:..:|:....::          :|:..|.: .:|.|||:|:|.:|.|
Mouse  8051 TLQCKVDGTPEIRISWYKEHTKLRSAPAYKMQFKNNVASLVINKVDHS-DVGEYTCKAENSVGAV 8114

  Fly   708 ASSASLLGFEDAQRSQQQKSEQLHENELQRNYSLSTIQEERTSQLYET---PVGDITIDEKGDVS 769
            ||||.|:               :.|.:|..:::      .:...::||   ||.         ..
Mouse  8115 ASSAVLV---------------IKERKLPPSFA------RKLKDVHETLGFPVA---------FE 8149

  Fly   770 FSFDGKE-VSVSLYETPDLTEEEA------------LKIVEMYADQISEHVTEHNIVELPPLRFV 821
            ...:|.| :.||.|:..:|.:::|            |:|::  .||  .||.::|.....||   
Mouse  8150 CRINGSEPLQVSWYKDGELLKDDANLQMSFVHHVATLQILQ--TDQ--SHVGQYNCSASNPL--- 8207

  Fly   822 KETSQSGKLLMEAVVIDISPEYFTVEDDMRTEADMDDISINEITVHGSSGREGRVDRETEQYVQQ 886
            ...|.|.||::....:   |.:|          |:..:|: ::.:..|...:..|.......:..
Mouse  8208 GTASSSAKLILSEHEV---PPFF----------DLKPVSV-DLALGESGSFKCHVTGTAPIKITW 8258

  Fly   887 SFDKMEEELSLSAPIRKRKKSKPTETDEFFSLSKASGSQGDEETSELQTFASAQMSASQKAASGA 951
            :.|..|        ||.....|.|..:...:|:....::||  ..:...:||   :.:.|.:..|
Mouse  8259 AKDNRE--------IRPGGNYKMTLVENTATLTVLKVAKGD--AGQYTCYAS---NVAGKDSCSA 8310

  Fly   952 QASPEKDKDSVAPPKRKKSKKPTDTDSSKTTEDDARLQ---DISGAVGDGLMVTQSSHAKVV--S 1011
            |...::      ||:..|.     .|.|:..:.|...:   .|.|          |...||:  .
Mouse  8311 QLGVQE------PPRFIKK-----LDQSRIVKQDEYTRYECKIGG----------SPEIKVLWYK 8354

  Fly  1012 DENEINKNLIALVPLAKLLKVIDNHLSAVENEVMEQSTMMMTPSAADQSIA-------IIRNIIE 1069
            ||.||.::....:.....:.:::.|..:||:.............:|..|.:       :.|....
Mouse  8355 DEVEIQESSKFRMSFEDSVAILEMHSLSVEDSGDYTCEARNAAGSASSSTSLKVKEPPVFRKKPF 8419

  Fly  1070 PIKQIESKLRVYSGETQIDALIQ-------SMDEDIRRLHMGLQVIEKCVEIDETGATLIQRTSV 1127
            |::.::      ..:..::..:|       |..:|.|.|..|    :|...:.|...|.|...:|
Mouse  8420 PVETLK------GADVHLECELQGTPPFQVSWHKDKRELRSG----KKYKIMSENLLTSIHILNV 8474

  Fly  1128 CIIDSVAEQMKRALEE------LKIVSRKFESECLRAQIELTADDIQQGLEITQGTIKSQALLQE 1186
            ...| :.|...:|..:      :..|:.|...:.::...:::.        |....::.|..::.
Mouse  8475 DTAD-IGEYQCKATNDVGSDTCVGSVTMKAPPQFVKKLTDIST--------IIGKEVQLQTTIEG 8530

  Fly  1187 AQELEAAKHFSETVEKMQE-----VPDSMSFATISEANLPSEASALKDICQPVAKIQEALERVEM 1246
            |:.:..| .|.:..|.::|     :..|.:.||: :.:....|:|.|..||           ::.
Mouse  8531 AEPISVA-WFKDKGEIVRESDNIWISYSENIATL-QFSRAEPANAGKYTCQ-----------IKN 8582

  Fly  1247 ELSLEESEEQIYKKVHQKVLESIVEPIKQLQSTLQSIEDKTESLAGSESIEQKINMAILDIVTPP 1311
            :..::|....:          |::||        .:|.:|.||:..:......:...:..  ||.
Mouse  8583 DAGMQECYATL----------SVLEP--------AAIVEKPESIKVTTGDTCTLECTVSG--TPE 8627

  Fly  1312 LFE--LKKGLEVILNEKSG----SVEGGMRTVSTV--ESMVPPLQEIQNGLAQLGQELQSGQDSV 1368
            |..  .|.|.|:..:.|..    :...|::.::.|  :|.|... |:||.:         |:||.
Mouse  8628 LSTKWFKDGKELTSDNKYKISFFNKVSGLKIINVVPGDSGVYSF-EVQNPV---------GKDSC 8682

  Fly  1369 PQEQLRSEPVMGVADTQKLLQSFAQAVLHFETN-------IERISARLSPNVKIRLLNLKDELSA 1426
            ......|:.::..:.|:||.          |||       :.......||.:.:...:..:|:|:
Mouse  8683 KVSIQVSDRIIPPSFTRKLK----------ETNGLSGSSVVMECKVYGSPPISVLWFHDGNEISS 8737

  Fly  1427 LIGAILEREITGHHVELLDRLKRPVDELNYCIRQTEVKNMTGSLADLI--EPLSMLQENTQKGHQ 1489
              |...:..:|.:...|...:....|..:|....|.|.......|.|.  ||.|.:|        
Mouse  8738 --GRKYQTTLTDNTCALTVNMLEEADAGDYTCIATNVAGSDECSAPLTVREPPSFVQ-------- 8792

  Fly  1490 RLLVAREPDQQALQTLDNI--RSLIRNVVIDIEEHEFKILQQEIQQDEEQASQQQDKSFSALRKV 1552
                  :||...:.|..|:  .|:::.      ...|.:              ...|..:.|...
Mouse  8793 ------KPDPMDVLTGSNVTFTSIVKG------SPPFTV--------------SWFKGSTELVPG 8831

  Fly  1553 LETKVSLEEAVGNIETLQEALNKISENPKASERVKSSSNEA--------------QVYLLRI--L 1601
            ....|||:::||.:|...      .:..::.|.....||||              .:::.|:  .
Mouse  8832 ARCNVSLQDSVGELELFD------VDTSQSGEYTCIVSNEAGRASCTTRLFVKAPAIFVKRLNDY 8890

  Fly  1602 QIAKGL-----ATFSEAETTLDVNEANTTRILF--ECGKSFADLAKALHSPESLTESEFINALNQ 1659
            .|.||.     .|||.........:.|...::.  .|..:..:.:..|....|..|..     .|
Mouse  8891 SIEKGKPLILEGTFSGTPPISVTWKKNGINVIASQRCNITTTEKSAILEILSSTVEDS-----GQ 8950

  Fly  1660 FGDIV--GQQKESMDEKLSIASPLSSLIHVLQNLKPPRASMEDLSTLDDVSVLKSVAESLPTDPD 1722
            :...:  ...|:|...::.|..|    .:.::.|:|.:.::.|.::|..         .|...|:
Mouse  8951 YNCYIENASGKDSCSAQILILEP----PYFVKQLEPVKVTVGDSASLQC---------QLAGTPE 9002

  Fly  1723 VEVP--KGTEKPSTVAVLLSDLNQGITSVLSHSEDPDVVSLSGTAAQQVQAALVKMQELQSS-LA 1784
            :.|.  ||..|....|.........:.:::....|      |..:.:.:..|...:.|:.|| ..
Mouse  9003 IGVSWYKGDTKLRPTATCKMHFKNNVATLVFTQVD------SSDSGEYICRAENSVGEVSSSTFL 9061

  Fly  1785 VVQETNLVEAAHSMSEASQQGTFAEALCSLERCV--LQVEECMAHSGVESLTDLELSKLKTLATP 1847
            .|||..|            ..:|:..|..::..|  ..|.|| |.||.|.::   :|..|. ..|
Mouse  9062 TVQEQKL------------PPSFSRQLRDVQETVGLPVVFEC-AVSGSEPIS---VSWYKD-GKP 9109

  Fly  1848 LHDVRQYCEQIDVQLLENVIDISTHGDISELKSSGHQQTVSDHIQEVA-----VVEEEPQVEVFD 1907
            |.|    ...|....|:|:..::.......| |..:..|.::.|...:     ::.|......||
Mouse  9110 LKD----SPNIQTSFLDNIATLNIFKTDRSL-SGQYSCTATNPIGSASSGAKLILTEGKNPPFFD 9169

  Fly  1908 I----QQGVASGIKQLEAC-------LEVTQTDANKELQQVGKIMEQLKSDLENIQIALVTDTVQ 1961
            |    ...|......|| |       ::||....|:|::..|           |.||:.:.::..
Mouse  9170 IPLAPMDAVVGESADLE-CHVTGTQPIKVTWAKDNREIRSGG-----------NYQISYLENSAH 9222

  Fly  1962 ------------QETVLAQAQIAR----TMFRLKECLV-HTYESGLVDSLENVE-SAFEDILLSL 2008
                        |.|..|..::.:    ....:||.|: .::...|.:::|..| ::|:      
Mouse  9223 LTIVKVDKGDSGQYTCYAVNEVGKDSCTAQLNIKERLIPPSFTKKLSETVEETEGNSFK------ 9281

  Fly  2009 PILESQLAEEMFAKIEKAFANFVAYCERPEAVDYQKLKTLKQPIENLVGSIGAVAAQPTVDVD-- 2071
              ||.::|.                 .:|..|.:.|               ..|...||.:.:  
Mouse  9282 --LEGRVAG-----------------SQPITVAWYK---------------NNVEIHPTSNCEIM 9312

  Fly  2072 -KSSSVVVQLQTSLMA---AFRCINDVSEQISNEVLGGLLKTQSSLV------AVFDFIEGNDNT 2126
             |::::::|::.:.||   .:.|      :.:|:. |..|.|.|.::      .|||        
Mouse  9313 FKNNALLLQVKRASMADAGLYTC------KATNDA-GSALCTSSIVIKEPKKPPVFD-------- 9362

  Fly  2127 IRVIELLQEMDSITAELKALSE-------IHVEPTVPIDI-----GIIIE-------NVSSGKAF 2172
                   |.:..:||     ||       .||:.:.||.|     |..::       :.:||.|.
Mouse  9363 -------QHLAPVTA-----SEGDSVQLSCHVQGSEPIRIQWLKAGREVKPSDRCSFSFASGTAM 9415

  Fly  2173 LTEIEEGLRVNN---------------PTCILLLDENTDDIAQLEATLVQIEKEILSQPQLSQIT 2222
            | |::|..:.::               ..|.:.:.|........:...|..:...:|:||..::.
Mouse  9416 L-ELKETAKADSGDYVCKASNVAGSDTSKCKVTIKEKPAAAPAAKKAAVDGKLFFVSEPQSIRVV 9479

  Fly  2223 TKQFALI----------------------------------DALQLQISNLQE---------KLN 2244
            .|..|..                                  |..:|:|.:..:         ..|
Mouse  9480 EKTTATFIAKVGGDPIPNVKWTKGKWRQLNQGGRILIHQKGDEAKLEIRDTTKTDSGLYRCVAFN 9544

  Fly  2245 KLNVFLSELQSQSDVSSPESALDTDI--------DLKEGSGSQEDIE-PEAKR---PK------- 2290
            |.....|.:..|.|....:..::.|:        .||:|||.:|:|: .|..:   ||       
Mouse  9545 KHGEIESNVNLQVDERKKQEKIEGDLRAMLKKTPALKKGSGEEEEIDIMELLKNVDPKEYEKYAR 9609

  Fly  2291 ---------MLESEQQLDSYKQTETQ----EEVPKETDDETK---------------------KD 2321
                     :|::.:.|...::.||.    ||:.|...||.:                     ||
Mouse  9610 MYGITDFRGLLQAFELLKQSQEEETHRLEIEELEKSERDEKEFEELVAFIQQRLTQTEPVTLIKD 9674

  Fly  2322 IEVESKLENQNELVAKKD------EQKADKVSEQEKLQES-KQQTEVDDTQKSTEVVSQKASPEN 2379
            ||.::.|:: |:.:.:.|      |.|.......|||:.| |.:..:|..:.:..|  :...|::
Mouse  9675 IENQTVLKD-NDAIFEIDIKINYPEIKLSWYKGTEKLEPSNKYEISIDGDRHTLRV--KNCQPKD 9736

  Fly  2380 ------------------ILEALSEKLSQSPNNATQNDEIKTIMTECQDILDNIDN-------IE 2419
                              ::|...|:..|   :.|..:.....|| ||..:.|:.:       :.
Mouse  9737 QGNYRLVCGPHIASAKLTVIEPAWERHLQ---DVTLKEGQTCTMT-CQFSVPNVKSEWFRNGRVL 9797

  Fly  2420 KVSKSIFKLREHIVH--TFDGKPPEEQTEKELVEKLIESLFESCPEA--------------TEHV 2468
            |....:....||.||  |......|:|.:.....:.:|:..|...||              :||.
Mouse  9798 KPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEAEPIQFTKRIQNIVVSEHQ 9862

  Fly  2469 IQTYIKEIK-TNIILT--KAAIQLI-----------------------DDSNLFTKPSLLVPKLV 2507
            ..|:..|:. .:.|:|  |...:|.                       ||..:::..:.|.|: .
Mouse  9863 SATFECEVSFDDAIVTWYKGPTELTESQKYNFRNDGRCHYMTIHNVTPDDEGVYSVIARLEPR-G 9926

  Fly  2508 NLEKLSELTQTVKLIDKSSKEMIGLQQNLMDIFIILDDLLDERT------------EKINPKIEN 2560
            .....:||..|.|.|....|.               .|:.|.|.            |:|.|.:..
Mouse  9927 EARSTAELYLTTKEIKLEMKP---------------PDIPDSRVPIPTMPIRAVPPEEIPPAVAP 9976

  Fly  2561 IKKILLSEYDYIEKKEGQLNTAVVNGKIKLITEKILDICEEFKQIIESQNQNKDAAG-------- 2617
            ...:||...:  |||.......|....:|..|:|::             .:.|:.|.        
Mouse  9977 SIPLLLPLPE--EKKPPAKRIEVTKKGVKKDTKKVV-------------TKPKEEAPPPPVPEVA 10026

  Fly  2618 ----------DIKKSETEDVVDHSIEKKIEEPKRSEKKDLDKEFLEEKELKASAKKQGDQDIEQK 2672
                      ..|.||..||...:.|.||....|.::...:||.:.|:|.....||...:..|:.
Mouse 10027 KKPPPPTPMIPAKASEIIDVSSKAEEVKITTITRKKEVHKEKEAVYEREEAVYEKKVHIEPWEEP 10091

  Fly  2673 SQKPEVSEVVAEKISEGKIEEPKKP-EEMDTEAKSEKATVLDKQVLE--EKELEASAE------- 2727
            .::.| :|...|...|...|||.:. ||:..|||        |||.|  |::.|...|       
Mouse 10092 YEELE-TEPYTEPYEEPYYEEPDEDYEEIKVEAK--------KQVHEEWEEDFEEGQEYYEREEG 10147

  Fly  2728 -KQGDQDVEKKSQKPEVSEVVAE------------KISEETIEEP---KKPEVKDTEIKSEKATA 2776
             .:|:::.|:...:.|:.:|..|            |:.|:.:..|   |||.|:    |.||.| 
Mouse 10148 YDEGEEEWEEIYHEREIIQVQKEVHEELHEKKIPAKVPEKKVPPPKVVKKPVVE----KVEKTT- 10207

  Fly  2777 LDKQVLEEKELEASAQKQCDQDV--EKKSQKPEVSEIVAEKI-----SEKTIEEPKKPEVKDTEI 2834
               :.:||::::.....:..:.:  :|.|:.|...||:..|:     .:..|.|.|......||.
Mouse 10208 ---RRMEEEKVQVIKVPEVSKKIVPQKPSRTPVQEEIIEVKVPAVHTKKMVISEEKMFFASHTEE 10269

  Fly  2835 K-SEKATALDKQVLEEKELEASAQK--QGDQDVEKKSQKPEVSEVVAEKISEETIEEP--KKPEV 2894
            : |.....:.|:.:.|:::..:..|  :....|.:..:||...|||...|.:: :|.|  |.||.
Mouse 10270 EVSVSVPEVQKKTVTEEKIHVAVSKKIEPPPKVPEPPKKPVPEEVVPVPIPKK-VEPPAAKVPEA 10333

  Fly  2895 KETEVKSEKATVLDKQVLEEKELEASAQKQGDQDVEKKFQKAEVSEVVAEKISEETIEEPKKPEV 2959
            .:..|..||     |.|...|:.|.:|..|             |.|...:...||.|   ..|..
Mouse 10334 PKKPVPEEK-----KPVPIPKKKEPAAPPQ-------------VPEAPKKPAPEEKI---PVPVT 10377

  Fly  2960 KDTEIKSEKATALDKQVLEEKELEASAQKQGDQDVEKKSQKPEVSEVIAEKISEEKIEEPKKPEE 3024
            |..|....|...:.|:|:.|:::....|::       :|..|.|.|:..:|:.||     |:|..
Mouse 10378 KKKEAPPAKVPEVQKKVVTEEKIAIITQRE-------ESPPPAVPEIPKKKVPEE-----KRPVP 10430

  Fly  3025 KETEVKSEKATVLDKQVLEEKELEASAQKQGDQDVEKRSQKPEVSE--VVAEK--VSEGKI---- 3081
            ::.||...|..|..|:.:.|..:.|...|       |...:.|||:  ||.||  .:|.|:    
Mouse 10431 RKEEVPPPKVPVPPKKAVPEAVVPAPIPK-------KAPPRAEVSKKTVVEEKRFAAEEKLSVAV 10488

  Fly  3082 -----------------EEPKKPEV---KETEAKSEKATTLDMQVLEERELEASAQKQGDQDVEK 3126
                             ||.::..|   :|.|...|:|...:.:||||.|         :..||:
Mouse 10489 PQRVELMRHEEEEWTYSEEEERVSVSVYREEERDEEEAEITEYEVLEEPE---------EYVVEE 10544

  Fly  3127 K----SQKPEVSEVIAEKISEEK-IEEPKKPEEKETEVKSEKATVLDKQVLEEKELEASAQKQ-- 3184
            |    |:|.||...   |:.|:| |.:||.|.:.| |....|.....|:::.||::.|.|.|:  
Mouse 10545 KMHFISKKVEVEPA---KVPEKKIIPKPKVPAKIE-EPPPTKVPEPPKKIVPEKKVPAPAPKKVP 10605

  Fly  3185 -GDQDVEKKSQKPEVSEVVAEKVSEGKIEEPKKPEVKETEVKSEKATTLDKQVLEEKELEASAQK 3248
             .....|.|...|| ....||:|.   ||||...:|.|..:|..:         |||.|.|..:|
Mouse 10606 PAKAPEESKRPVPE-KRAPAEEVG---IEEPPPTKVAERHMKITQ---------EEKVLVAVTKK 10657

  Fly  3249 QGDQDGKSRDDIIKTLKE----------------RLTELSKALGS----SVDEILRESR---EIV 3290
            :.....:..::..|...|                ::||:.|....    |::...||.|   |:.
Mouse 10658 EAPPRARVPEEPKKVAPEERFPKLKPRREEEPPAKVTEVRKRAVKEEKVSIEVPKREPRPTKEVT 10722

  Fly  3291 NNLE-------DDKVVAKHLFKLRDHIVHTYDG----KRGEENKEKELFESFIELLCEASPEAAE 3344
            ...|       :::.|::|    |:.....|:.    |..||.:..|.::.:.| ..|...|..|
Mouse 10723 VTEEKKWSYTREEETVSEH----REEEYEDYEDYEEYKEFEEYEPTEEYDQYDE-YAEREVEHYE 10782

  Fly  3345 KVKLNYLKEIKTNVILTKATIQLIDDSNMFTKPSLLIPKLLNL----ERVAVKIQS--ETYVDKS 3403
            :.: .|:.|.|..|.:..|      ...:..||....||:|..    |:..:.||.  :....|:
Mouse 10783 EHE-EYVTEPKKPVPVKPA------QEPVPAKPKAPPPKVLKKAVPEEKAPLPIQKKLKPLPPKA 10840

  Fly  3404 SEKMISLQQSLMDIFVILDDFLDDETEVLKPKI-ENIKTTLLSDYDYIEKKDGPLLTAVINGKIN 3467
            .|:...:.:..:.|.:         |:..|.:: |.:....:.....:.:...|..|..:...:.
Mouse 10841 PEEPKKVVEEKIQISI---------TKREKQQVTEPVAKVPMKPKRVVPEAKIPAPTKEVAVPVR 10896

  Fly  3468 VVSQHILTIIEEV---KQLTENHDQKEKDVSNAEADNFADEKREESQKEEIKDSEAKHKKSKVSE 3529
            |........:|||   |:..|.|::...:    |.:.:..|:....::|.:.:.|..||:..:.|
Mouse 10897 VPGVPKKRELEEVVVFKEEVEAHEEYIVE----EEEEYVHEEEYVHKEEYVHEEEYVHKEEYIHE 10957

  Fly  3530 KKSIEEEKLEDKKEKQTESAIDEKSQKAEVSEIVSEK--ITDEKAQESQKKEV---KGSEAKPKK 3589
                |||.|.:::|...|.         ||..:...|  :..:|....:||.|   |..||.|.|
Mouse 10958 ----EEEHLHEEEETIAEE---------EVVPVAPVKVPVVPKKPVPEEKKPVPVPKKKEAPPAK 11009

  Fly  3590 AKVLEKKSIEEEKLE---DKKEKQTESAIDEKSQK-------------------AEVSEIVSEKI 3632
            ...:.||  .|||:.   .||||...:.:.|..:|                   |:|.|:..:.:
Mouse 11010 VPEIPKK--PEEKVPVPIPKKEKAPPAKVPEVPKKPVPEEKPPVPVPKKVEPPPAKVPEVPKKPV 11072

  Fly  3633 TDEKAQESQKKEVKDSEAKPKKAKVLEKKSIEEAK----LEDKKETQTDSA-------------- 3679
            .::|......|:|   ||.|.|...:.||.|.|.|    |..|.|.....|              
Mouse 11073 PEKKVPAPTPKKV---EAPPAKVPEVPKKPIPEEKKPTALLKKMEAPPPKAPKKREVVPVPVALP 11134

  Fly  3680 IDEKSQKAEVSETVSEKITDEKAQESQKEEVKDSEAKPKKAKVL-EKKSI---EEEKLEDKKEKQ 3740
            .:|:.::....|...|:|..|:...|: ||....|..|::.:|| |::.:   |||.|.:::|.|
Mouse 11135 REEEEEEVPFEEVPEEEILPEEEVPSE-EEAPPEEVPPEEEEVLPEEEEVLPEEEEVLPEEEEVQ 11198

  Fly  3741 TE-------------------SAIDEKSQKAEVSEIVS----EKITDEKAQESQKKEV--KDSEA 3780
            .|                   ..:.||.....|.:.|.    .|:.:.|.:..:||.|  |..||
Mouse 11199 PEEEALPEIKPKVPKPAPVPKKTVPEKKVPVPVPKKVEPPPPPKVPEIKKKVPEKKVVVPKKEEA 11263

  Fly  3781 KPKKAKVLEKKSIEEEKLED---KKETQTDSAIDEKSQKAEVSEIVSEKITD-------EKAQES 3835
            .|.|..|:.||...|:|:..   ||.....:.:.|.|:|.|...|:..|..:       |:|:|.
Mouse 11264 PPTKVPVVPKKPEPEKKVPVPALKKAVVPPAKVPEVSKKVEERRIIPPKEEEVPPAEVYEEAEEP 11328

  Fly  3836 QKEEVKDSEAKPKKAKVLEKKSIEEEKLEDKKEKQTESAIDEK----SQKAEVSEI-VSEKITDE 3895
            ..||:.:.....::.:::|::..|||.|..:..:..:.|:.|.    .:|||.... |.:||.:|
Mouse 11329 TPEEIPEEPPSIEEEEIVEEEEEEEEVLPPRAPEVVKKAVPEAPTPVPKKAEAPPAKVPKKIPEE 11393

  Fly  3896 KAQ-ESQKKEVKGSEAKPKKAKVLEKKSIEEEKLE-DKKEKQTESAIDEKSQKAEVSEIVSEKIT 3958
            |.. ..||||...::......||.|||.|.|:|:. .|||     |:.....||    :..|||:
Mouse 11394 KVPVPVQKKEAPPAKVPEVPKKVPEKKKIPEKKVPVPKKE-----AVPPAKGKA----VFEEKIS 11449

  Fly  3959 DEKAQESQMEEVKDSEAKPKKAKVLEKKSIEEEKLENKKEKQTESAIDEKSQKAEVSEIVSEKIT 4023
            ....||..::|  ..|.:..:|||  :::.|||:....:|      ..|:.:..||.|.:  ::.
Mouse 11450 VAYQQEELVQE--RIELELVEAKV--EEAFEEEEFHEVQE------YFEEEEFHEVEEFI--RVE 11502

  Fly  4024 DEKAQESQKKE-----VKDSEAKP----KKAKVLEKKSIE-EEKLEDKKEKQTESAIDEKSQKAE 4078
            :.:.||..|.|     ::..||:.    :|.|:..||..| .||:...|:..|: .|..|...|:
Mouse 11503 ERRFQEEHKVEEVHRVIEFLEAEEVEVYEKPKIPPKKGPEVSEKVIPPKKPPTK-VIPRKEPPAK 11566

  Fly  4079 VSEIVSENITDE-------------KAQESQKK---EVKDSEAKPKKAKV-------LEKKSIEE 4120
            |.|:..:.:.:|             ||.|..||   |.|..||.|||.:|       :.||.|:|
Mouse 11567 VPEVTKKTVVEEKIRAPEEPKVPAPKAPEVPKKITPEEKVREAVPKKPEVPPPKVPEVPKKIIQE 11631

  Fly  4121 EKL-----EDKK----ETQTDSAIDEK----SQKAEV---------SEIVSEK---ITDEKAQES 4160
            |||     ||.:    |...::.|:|:    .|||.:         ..:|:|:   :|..|.:|:
Mouse 11632 EKLPVVLPEDTEIYMYEASEETVIEEEHVTLPQKARLKVAKVPAPPQTVVTEEKTYVTIRKTRET 11696

  Fly  4161 ----QKEEVKDS--EAKPKKA--KVLEKKSIEE-EKLED-KKEKQTESAIDEKSQKAEVSEIVSE 4215
                :.|..:::  |.|..||  ::.|..|.|: |.:|| ..||:..::...|:|.....|...|
Mouse 11697 LALKESETTREAFPELKSYKAVPEIPEPPSPEDLEIIEDVLPEKRPPASKRRKTQLPTAPEAPRE 11761

  Fly  4216 -----NITDEKAQESQKKEVKDSEA------------KPKKAKVLEKKSIEEEKLEDKK-----E 4258
                 |..:|.:.|.:....::.||            ||:.|..:......:|...:||     .
Mouse 11762 MPPEMNTFEEISVEPEMLPTQEPEAPTEVDVAKRAPSKPRGAPAVTVLDTYQEATVEKKTLRISR 11826

  Fly  4259 KQTESAIDEKSQKAEVSEIVSEKITEEKAQESQKKEVKDSK--AKPKKAKVLEKKSIEEAKLEDK 4321
            |:.|...||     ||.|...|.:.::|....|..||...|  ..||:. |.|:||:||   ..|
Mouse 11827 KKPELPSDE-----EVPEAPREVVAKKKVLPPQVPEVVPVKVPGAPKEV-VSERKSLEE---PPK 11882

  Fly  4322 KETQTDSAIDEKSQKAEVSEIVSEK--------------ITDEKAQE---SQKEEV----KDSEA 4365
            |.......:.|     |..|::.||              :|..:|.|   |:.||.    ::.||
Mouse 11883 KPAVRPVTVPE-----EPKEVIPEKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEA 11942

  Fly  4366 KPKKAKVLEKKSIEEEKLENKKEKQTESAIDEKSQKAEVSEIVSEKITDEKAQESQKKEVKGSEA 4430
            .|.|.....|:.:.|:|:.....|:.|      :..|:|.|...|...::|...:.||:   .||
Mouse 11943 PPAKVPEAPKEVVPEKKVSVVPPKKPE------APPAKVPEAPKEAAPEKKVPVAPKKK---PEA 11998

  Fly  4431 KPKKAKVLEKKSIEEEKLEDKKEKQTE-----------SAIDEK-----------SQKAEVSEIV 4473
            .|.|.....||.:.|:||.....|:.|           :|:.:|           |...||.|:.
Mouse 11999 PPVKVPEAPKKVVPEKKLPVAAPKKPEAPAAEVPEVPKTAVPQKKIPEAIPPKPESPPLEVPEVP 12063

  Fly  4474 SEKITDEKAQESQKEEVKDSEAKPKKAKVLEKKSIEEAKLEDKKETQTDSAIDEKSQKA-----E 4533
            .:::|.||         |...|.|.|.::...| :.||......|.:|..|:.:|::.|     :
Mouse 12064 PKEVTPEK---------KVPAAPPTKPEIPPPK-VPEAPQAAVVEEKTPEALPKKAEAAPVPVPQ 12118

  Fly  4534 VSEIVSEK--------------ITDEKAQESQKEEVKDSEAKPKKAKVLEKKSIEEAKLEDKKET 4584
            |.|.|.||              :...|.|::..|:.: .||.||:.   |.:::...::::....
Mouse 12119 VQETVPEKTRPVGPPKKPEATTVPVPKVQKTIPEKTR-PEAPPKRP---EARTVPVPQVQETVPE 12179

  Fly  4585 QTDSAIDEKSQKA------EVSEIVSEK---ITDEKAQESQ-------KEEVKDSEAKPKKAKVL 4633
            :|......|..:|      ||.|.|.||   :...|..|:.       :|.:.:....|||.   
Mouse 12180 KTRPMAPPKKPEATTLPVPEVQETVPEKTRPVGPPKKPEATTVPVPEVQETIPEKTRPPKKP--- 12241

  Fly  4634 EKKSIEEEKLEDKKEKQTESAIDEKSQKA------EVSEIVSEK--------------ITDEKAQ 4678
            |...:...::::...::|......|..:|      ||.|.:.||              :...|.|
Mouse 12242 EATPVPVPEVQETVPEKTRPVGPPKKPEATTVSVPEVQETIPEKTRPAAPPKKPEATAVPVPKVQ 12306

  Fly  4679 ESQMEEVKDSEAKPKK--AKVLEKKSIEEAKLEDKKETQTDSAIDEKSQKA-------EVSEIVS 4734
            |:..|:.: .||.||:  |..:.....::|.:.:||..:    :..|..:|       |..|::.
Mouse 12307 ETIPEKTR-PEAPPKRPEATTVPVPEADQAVVPEKKVPR----VPPKKVEAPPITVPEEPKEVIP 12366

  Fly  4735 EK--------------ITDEKAQE---SQKEEV----KDSEAKPKKAKVLEKKSIEEEKLEDKKE 4778
            ||              :|..:|.|   |:.||.    ::.||.|.|.....|:.:.|:|:.....
Mouse 12367 EKKVSLVPPKKPAAPPVTVPEAPEEVFSEDEETLAPPQEPEAPPAKVPEAPKEVVPEKKVSVVPP 12431

  Fly  4779 KQTESAIDEKSQKAEVSEIVSEKITDEKAQESQKKEVKGSEAKPKKAKVLEKKSIEEEKLEDKKE 4843
            |:.|      :..|:|.|...|...::|...:.||:   .||.|.|.....||.:.|:||.....
Mouse 12432 KKPE------APPAKVPEAPKEAAPEKKVPVAPKKK---PEAPPVKVPEAPKKVVPEKKLPVAAP 12487

  Fly  4844 KQTE-----------SAIDEK-----------SQKAEVSEIVSEKITDE---------------- 4870
            |:.|           :|:.:|           |...||.|...|:|..|                
Mouse 12488 KKPEAPAAEVPEVPKAAVPQKKIPEAIPPKPESPPPEVYEEPEEEIVPEEPPEEAVEEPVPAPPP 12552

  Fly  4871 KAQESQKKEVKDSEAKP---KK-----AKVLE--KKSIEEEKLENKKEKQTESAIDEKSQKAEVS 4925
            |..|..||.|.:.:|.|   ||     |||.|  |::..|:|:..||         .::..|:|.
Mouse 12553 KVTEPPKKPVPEKKAPPAVVKKPEPPPAKVPEVPKEAPPEKKVPPKK---------PEAPPAKVP 12608

  Fly  4926 EIVSEKITDEKAQESQKKEVKDSEAK--PKKAKVLEKKSI---------------EEEKLEDKKE 4973
            |:..|.:|::|....:|.||..::..  |||..:.||.:|               |.|::..::|
Mouse 12609 EVPKEVVTEKKVAVPKKPEVPPAKVPEVPKKPVIEEKPAIPVVEKVASPPAEVYEEPEEVTAEEE 12673

  Fly  4974 KQTESAIDEKFQKAEVSETVSE---KITDEKAEESRKEEVKDSEAKPKKAKVLEKKSIEEEKLE- 5034
            :...:..:|:::.......|.|   |:..||    :...:|..||.|.|...:.||::..:|:. 
Mouse 12674 EPAPAVEEEEYEAPPPPAPVPEEPKKVVPEK----KFPVIKKPEAPPPKVPEVPKKAVPVKKVPV 12734

  Fly  5035 DKKEKQTESAIDEKSQK-----------------------------------------------A 5052
            .||.:..|:.:.|..:|                                               |
Mouse 12735 VKKPEPPEAEVPEVPKKLVPVKKEPVPVTKKTEVLPEKVPEAPKKITPEKKESVPVPEEPEAPPA 12799

  Fly  5053 EVSETVSEKITDEKA------QES---QKKEV------KDSEAKPKKAKI------LEKKSIEIE 5096
            .|.||..|.|.:|||      :|:   :::|:      ::.|.:|:..:|      .|||.||..
Mouse 12800 SVEETPEETIYEEKATITIGRKETPPVEEREIEKFIQPEEPELEPEPEEIPVQEPEPEKKVIEKP 12864

  Fly  5097 KLDEKKEKQTETKVATDTKSQTVEVSEIVLEKISEEKAEESQKVE---LKDSEAKSKKAKVLEK- 5157
            ||..:...:..:....|.|.:..::..:..:|: .||.|..:|||   ||...|:.|..|:|.: 
Mouse 12865 KLKPRPPARPPSPPKEDVKEKMFQLKAVSKKKV-PEKPEVVEKVEPAPLKVPTAEKKVRKLLPEP 12928

  Fly  5158 ----------KSTLKEKLDENDKKQKEDGATNKSQKAEAADVVPEKISEE--------------- 5197
                      ||.|::|.:|.:.| .|.....|::|.|.....|:.:..|               
Mouse 12929 KPQPKEEVVLKSVLRKKPEEEEPK-VEPKKVEKAKKPEEPQPPPKAVEVEAPPEPTPKERKVPEP 12992

  Fly  5198 -KVAEIKT------PEPMDSKAKSKPDGLPADEKSHGAKVSESVPVKNEAEKTDQLSAKKPTVLD 5255
             ||.|||.      |||     |.||:   .:.|:..|...|..|....|..|..:..||.....
Mouse 12993 AKVPEIKPAIPLPGPEP-----KPKPE---PEVKTMKAPPIEPAPTPIAAPVTAPVVGKKAEAKP 13049

  Fly  5256 EDLVVPKRKPYLAEQTADSISLQTYKSMDSEYKDRKESRSAKRKP-------------------T 5301
            :|.....:.|      ...::.:|...:::|.|..:.....::.|                   .
Mouse 13050 KDEAAKPKGP------IKGVAKKTPSPIEAERKKLRPGSGGEKPPDEAPFTYQLKAVPLKFVKEI 13108

  Fly  5302 VDIQLTNRNTASGSDLKLTCGLSGHEMNVQWFKDNCPIENGAKYRRTLNDGLSCLEIKSAELGDS 5366
            .||.||...:. ||.....|.:|.......|.||...|....|:|...:.....|.|...:|.|:
Mouse 13109 KDIVLTEAESV-GSSAIFECLVSPSTAITTWMKDGSNIRESPKHRFIADGKDRKLHIIDVQLSDA 13172

  Fly  5367 GIYRCIASNQNGEVETSCLVTIYEAPSSKFGTPPIFTRNIRDAYH-SQGNQLTLECKVSGSPKPH 5430
            |.|.|:....|.|..::..:.:.|.|..       |.:.:.:... .:|..|.|.|::  :.:..
Mouse 13173 GEYTCVLRLGNKEKTSTAKLIVEELPVR-------FVKTLEEEVTVVKGQPLYLSCEL--NKERD 13228

  Fly  5431 IYWQRDNTLLPIEGTKYQYEEQSDG---------IKLLTINNFGSNDSGLYTCYAESENGQMKIS 5486
            :.|::|..::          .:..|         ::.||||:....|:|.||...|:.| .::.|
Mouse 13229 VVWRKDGKIV----------VEKPGRIVPGVIGLMRALTINDADDTDAGTYTVTVENAN-NLECS 13282

  Fly  5487 KFVQASDYVRERIADKKPIDKVIQEIKRDESSSAAANDTAAAKAKAREAKLRLNLETSLKTMTIG 5551
            ..|:..:.:||.:.  |||        ||:.          .|.|                    
Mouse 13283 SCVKVVEIIREWLV--KPI--------RDQH----------VKPK-------------------- 13307

  Fly  5552 SGNKAQLICYVTGIIEDVHWLR---------NDE-RVTKDARHKIYNINGAISLEIYDARVEDSG 5606
              ..|...|.:.....::.|.:         ||: .:.|:..|....:..|:..:|.:..||..|
Mouse 13308 --GTAVFTCDIAKDTPNIKWFKGYDEIPLEPNDKTEILKEGNHLFLKVKNAMPEDIDEYAVEIEG 13370

  Fly  5607 -HYRCVVKNSRQTVESAGQLSVLDQSTGKLPESFSSGIIESYDDQRNEIVLSCQVIGRPSVSWMR 5670
             .|...:....:.||   .|..::..|....||.|.....|.:|...|..|..::: |||.:   
Mouse 13371 KRYPAKLTLGEREVE---LLKPIEDVTIYEKESASFDAEISEEDIPGEWKLKGELL-RPSPT--- 13428

  Fly  5671 DDHSICNNRYRTIEEPGGVRKLVIRNPISSDCG---IFACYAEHEDRIDSTSITIKAADLKRLIN 5732
                 |.     |:..||.|.|.:........|   ..||.|     |.:..:|:|..:|...:.
Mouse 13429 -----CE-----IKAEGGKRFLTLHKVKLDQAGEVLYQACNA-----ITTAILTVKEIELDFAVP 13478

  Fly  5733 VSQEEIPS---------IGDHESTPWSRSQSHLSSGSQ--VNGNGELH--RAGDRVLRNVG---- 5780
            :....:|.         :....:..||:....:.:..:  :..:|:.|  ...|....:.|    
Mouse 13479 LKDVTVPEKRQARFECVLTREANVIWSKGPDIIKASDKFDIIADGKKHILVINDSQFDDEGVYTA 13543

  Fly  5781 --KGKPL------------FHTLLHDRTVSEGANLRLVCSVSGDENTHIEWLKNHKPLPRSDNRY 5831
              :||..            |.:.|.|:||.||.....||.:| .|..|:.|.||...|    :..
Mouse 13544 EVEGKKTSAQLFVTGIRLKFISPLEDQTVKEGQTATFVCELS-HEKMHVVWFKNDVKL----HTT 13603

  Fly  5832 QTVYLNGEA---SLEIFAAVADDSGNYTCCATNDFGESLTHAQLRVYKNFKEAPLPSTFTQPIRD 5893
            :||.::.|.   .|||.....||.........|          |....|.|.......||..:.|
Mouse 13604 RTVLMSSEGKTYKLEIRETTLDDISQIKAQVKN----------LSSTANLKVLEADPYFTVKLHD 13658

  Fly  5894 TYSLNENELVLDCRV-RGQPRPEIQWIKGTEPIEASEKFKPSDQADGYAKLVIVNPTE-KDSGIY 5956
            ...:.::|::|.|.| :..|   ::|.|..|.|..|.|.  |.:.||..:::.:...| ||.|.|
Mouse 13659 KTGVEKDEIILKCEVSKDVP---VKWFKDGEEIVPSPKH--SVKTDGLRRILKIKKAELKDKGEY 13718

  Fly  5957 WCVARNEGAENKISHQVDFKGRQHYSLEKTHGFFHRDPNKPHFLLPLGNQTVCNGGTVAISAEFM 6021
            .|....:..:..::.:.     :...:||                ||....|..|.|.....|..
Mouse 13719 VCDCGTDTTKANVTVEA-----RLIKVEK----------------PLYGVEVFVGETARFEIELS 13762

  Fly  6022 ETSTPIEVKW-LRDRRVVDGPNVKALADRGVYTLTIMNAGPEVEGTYTCRASNAFGRIESNVNVD 6085
            |..  :..:| |:...:...|:.:.:.|...:.|.:.|...::.|..:.:|:||    :|..|:.
Mouse 13763 EPD--VHGQWKLKGEPLTASPDCEIIEDGKKHVLVLYNCQLDMTGEISFQAANA----KSAANLK 13821

  Fly  6086 VAVGAEKDERPPLFLSRPDTEMKIAVGDPFSLSFRIAGDPKPKLTF--MKGTKDITQSDRVSKEV 6148
            |      .|.|.:|:: |.:::|:...|.......::.:||   ||  :|||::||..||.  |:
Mouse 13822 V------KELPLIFIT-PLSDVKVFEKDEAKFECEVSREPK---TFRWLKGTQEITGDDRF--EL 13874

  Fly  6149 SDDYTRFS--VQQAQISDSGTYFVVARNNFGTDRI--------FVT----VTVNPRARSATPTQP 6199
            ..|.||.|  ::.|...|...|...|.:...:.::        |:|    ||...|..:....: 
Mouse 13875 IKDGTRHSLVIKSAAFEDEAKYMFEAEDKRTSGKLIIEGIRLKFLTPLKDVTAKERENAVFTVE- 13938

  Fly  6200 RWGLPLDSYSDTSYFRDPPGCISTEPLVV-DSGPTHISLSWGKPVSANSAPVMAYKVEAWVVGHE 6263
               |..|:. ..|:|::.....:::.:.: |.|.|| |::: |.:|.:....:  :|||..:..|
Mouse 13939 ---LSHDNI-PVSWFKNDQRLHTSKRVSMHDEGKTH-SITF-KDLSIDDTSQI--RVEAMGISSE 13995

  Fly  6264 GGAYWRELGLTPINSFDAFNLKPNVEYHFRVTPKNRYGWGPTVQTSSPLQVG------GVECLPE 6322
            ...                                      ||....|...|      |||    
Mouse 13996 AKL--------------------------------------TVLEGDPYFTGKLQDYTGVE---- 14018

  Fly  6323 FVKILPGQAKALLGSSFTLQCNMRGAPRPQVTWFKDGIQLSSSSERVKIRQIGSTCALTIATVSE 6387
                         .....|||.:..|..| |.|||||.:: ..|:.|.|:..|....|.:....:
Mouse 14019 -------------KDEVILQCEISKADAP-VKWFKDGKEI-KPSKNVVIKADGKKRMLILKKALK 14068

  Fly  6388 LDSGRYTCEATNSKGRVSTFARLQV---------------------------VSDSRIY------ 6419
            .|.|:|||:.    |...|..:|.:                           :|:..|:      
Mouse 14069 SDIGQYTCDC----GTDQTSGKLDIEDREIKLVRPLYSVEVMETETARFETEISEDDIHANWKLK 14129

  Fly  6420 -EA-----DSRLKE-------IAHGRNV----------ADVGDSLPIFTMRLRDRRVQVTYPVR- 6460
             ||     :..:||       |.|...:          |:|..|.   .:|::.|.:.:..|:: 
Mouse 14130 GEALLQTPECEIKEEGKIHVLILHNCRLDQTGGVDFQAANVKSSA---HLRVKPRVIGLLRPLKD 14191

  Fly  6461 ----------LTCQIVGYPVPEILWYKDDELIHTDRKHLISAEGQFFTLEIAATTLDDSGTYTCL 6515
                      ..|::....:| :.||...:.:..:.|.:..:||:..||.:....|:|:|.....
Mouse 14192 VTVTAGETATFDCELSYEDIP-VEWYLKGKKLEPNDKVVTRSEGRVHTLTLRDVKLEDAGEVQLT 14255

  Fly  6516 ARNELGSVSCHCTLVVDKGIRAYISP-DFYVPLDPFYIFREGSEIRLSTKVEAYPSVGVTWHRNG 6579
            |::    ......|.|.:      .| :|..||:...:..|.:.: |..:| :..:..|.|.:||
Mouse 14256 AKD----FKTQANLFVKE------PPVEFTKPLEDQTVEEEATAV-LECEV-SRENAKVKWFKNG 14308

  Fly  6580 MRLRPSRRLTATLDSNGYV-ELIIAEATVRDAGIYVCVASNVVGKVETICRVAVEEAENKAVAPQ 6643
            ..:..|::.....|  |.| :|||...|..|...|.|.|.:    .:|.|.:.|.....:.:.|.
Mouse 14309 TEILKSKKYEIVAD--GRVRKLIIHGCTPEDIKTYTCDAKD----FKTSCNLNVVPPHVEFLRPL 14367

  Fly  6644 RSLEIPSIKTDDLPYSKEPLFVVKPRSSEAYEGDNVIIFCEVVGDPKPEVVWLRDFLNPEYYKDA 6708
            ..|:                  ||.:.:..:|       || :.....:|.|.:|          
Mouse 14368 TDLQ------------------VKEKETARFE-------CE-ISKENEKVQWFKD---------- 14396

  Fly  6709 PHFRRIGDGPEYRLEIPSAKLDFTGTYSVIASNCHGEAKAVISLQIFAKDILNKSRMDKVHTR-- 6771
                        ..||...|     .|.:|       :|..:.:.:..|.:||.........|  
Mouse 14397 ------------GAEIKKGK-----KYDII-------SKGAVRILVINKCLLNDEAEYSCEVRTA 14437

  Fly  6772 --HGNIETLPR---FVRNLRNLRCCDGDAISLECHVEADPEPFIIWEK-DGHVMPSDRDYVMSFD 6830
              .|.:..|..   |.:||.||...:||.|.|.|.| :.|...:||.| |..::.:.|..::: |
Mouse 14438 RTSGMLTVLEEEAVFTKNLANLEVSEGDTIKLVCEV-SKPGAEVIWYKGDEEIIETGRFEILT-D 14500

  Fly  6831 GTKATLSIPRVYPEDEGEYTCVAKNSVGRSLSSACIIVDVPEEKENMLSRQLARPSGLLSAHSTP 6895
            |.|..|.|.....||.|.|.|...:|                                       
Mouse 14501 GRKRILIIQNAQLEDAGSYNCRLPSS--------------------------------------- 14526

  Fly  6896 RSTPRSTPARSFSPLRLSYRTSSIDLSGVAERRRSDARNAI--TAPKFLAIPYNRVVEEGDSVRF 6958
                                             |:|::..:  .|.:|::.|.|..:.||:...|
Mouse 14527 ---------------------------------RTDSKVKVHELAAEFISKPQNLEILEGEKAEF 14558

  Fly  6959 QCAISGHPTPWATWDKDGLIVTPTPRIAVKEIDDLRIIEIDEVTFDDAGLYRVTLENDFGRIEAT 7023
            .|.||..... ..|.:|...:....:..:......|::.:.:.|..|.|.|.|.:    |...|.
Mouse 14559 VCTISKESFE-VQWKRDDQTLESGDKYDIIADGKKRVLVVKDATLQDMGTYVVMV----GAARAA 14618

  Fly  7024 ARLDVIRSSRYSKSPSVRSVRASSSRRNAHLYRRIMGP--STAIGGRMALASGYR-GSSVPSVRF 7085
            |.|.||..                        .||:.|  .|.:..:..:..... .:.....::
Mouse 14619 AHLTVIEK------------------------LRIIVPLKDTKVKEQQEVVFNCEVNTEGAKAKW 14659

  Fly  7086 YHNDVELEASERVHILLQDSMALLIVDNVTREDEGQYTCIISGDHDPLITSTTVTFHDSNTEIRR 7150
            :.|:..:..|.:..||.:|.:..|.:.:...:|:..:...::......:.|.      :|..:..
Mouse 14660 FRNEEAIFDSSKYIILQKDLVYTLRIRDARLDDQANFNVSLTNHRGENVKSA------ANLIVEE 14718

  Fly  7151 RRAVITERLPEITKSLEGEVIDLCCSIECDEPYSYVWLRNGEIL--------------------- 7194
            ....|.|.|.:| :::|.:.:...|.:. ....:..|.:|||.:                     
Mouse 14719 EDLRIVEPLKDI-ETMEKKSVTFWCKVN-RLNVTLKWTKNGEEVAFDNRISYRIDKYKHSLIIKD 14781

  Fly  7195 ---PDSDEF--------------------NYIDHGNGRLCLRINDAFDIDSGIYSCQVFTS---- 7232
               ||..|:                    .:::|      |......:.|..::|||:...    
Mouse 14782 CGFPDEGEYVVTAGQDKSVAELLIIEAPTEFVEH------LEDQTVTEFDDAVFSCQLSREKANV 14840

  Fly  7233 -------DINDSTSDSTFDSHSICSLINSGC---SDCSSSGELC-VLERDLRGQ---DEECVQLL 7283
                   :|.:..........||..||...|   .:|..:   | |.:|..|.:   :|..|:::
Mouse 14841 KWYRNGREIKEGKKYKFEKDGSIHRLIIKDCRLEDECEYA---CGVEDRKSRARLFVEEIPVEII 14902

  Fly  7284 KTPLPVVCASGDEALFYARVFPCDAEADWYLNGQLLAQADDSLNMTLESYPENGIRLLRMRDVTA 7348
            :.|..::.|.|.:.:|.|.:.....|..|..|..::.|.|....|:     |..|..|::.|:..
Mouse 14903 RPPQDILEAPGADVIFLAELNKDKVEVQWLRNNMIVVQGDKHQMMS-----EGKIHRLQICDIKP 14962

  Fly  7349 SRSGEICLQVKHPQAEFRRIPTTRTYTSLLVLPAIRGNSSSSSLAARSCILTRPEDCTALIGGHV 7413
            ...||.....|..:|.                       :...|||...|.|..:|.....|..:
Mouse 14963 RDQGEYRFIAKDKEAR-----------------------AKLELAAAPKIKTADQDLVVDAGQPL 15004

  Fly  7414 RLSVRYEPFPGTKVIWYKACHPIVESSNVTIRTTSQQSTLYITDISADDSGKYTVEVMNDYGVEA 7478
            .:.|.|:.:|..:..|:|...|:   |..|:.||::|::..|::...||.|:|.:.:.|.:|...
Mouse 15005 TMVVPYDAYPKAEAEWFKENEPL---STKTVDTTAEQTSFRISEAKKDDKGRYKIVLQNKHGKAE 15066

  Fly  7479 AAASVAVEGPPEPPSGQPSVSLGPDRVAVAWCGPPYDGGCMITGFIIEMQTIGDENCDEDSWQQV 7543
            ...::.|...|.|.............|::||..|..|||..|.|:::|.:.|     ...:|..|
Mouse 15067 GFINLQVIDVPGPVRNLEVTETFDGEVSLAWEEPLTDGGSKIIGYVVERRDI-----KRKTWVLV 15126

  Fly  7544 TRVVDSLAYTVKNLQPER-QYRFRVRAENIHGRSAPGQASELVQ------ITNTPQRSTSSDASD 7601
            |...||..:||..||... :|.|||.|.|..|...|.:....|:      :...|...|.:|. :
Mouse 15127 TDRADSCEFTVTGLQKGGVEYLFRVSARNRVGTGEPVETDSPVEARSKYDVPGPPLNVTITDV-N 15190

  Fly  7602 RFG------------------------------------------QATVS-VQSGGDFKSRFEII 7623
            |||                                          .|||: |..|.::..|....
Mouse 15191 RFGVSLTWEPPEYDGGAEITNYVIELRDKTSIRWDTAMTVRAEDLSATVTDVVEGQEYSFRVRAQ 15255

  Fly  7624 EELGKGR------------------------------------------------FGIVYKVQER 7640
            ..:|.|:                                                .|.:.:.:|.
Mouse 15256 NRIGVGKPSAATPFVKVADPIERPSPPVNLNASEQTQSSVQLTWEPPLKDGGSPILGYIIERREE 15320

  Fly  7641 G---------QPEQLLAAKVIKCIKSQDRQKVLEEISIMRALQHPKLLQLAASFESPREIVMVME 7696
            |         :|...|..||...   |...|.|..:|          .:.||....|.||:    
Mouse 15321 GKDNWIRCNMKPVPELTYKVTGL---QKGNKYLYRVS----------AENAAGVSDPSEIL---- 15368

  Fly  7697 YITGGELFERVVADD-FTLTEMDCILFLRQVCDGV----------------------AYMHGQSV 7738
                |.|    .||| |....||...|.    ||:                      .:..|..|
Mouse 15369 ----GPL----TADDAFVEPTMDLSAFK----DGLEVIVPNPIKILVPSTGYPRPKATWTFGDQV 15421

  Fly  7739 VHLDLKPENIMCHTRTSHQIKII------DFGLAQRLDTKAPVRVLFG-------TPEFIPPEI- 7789
            :.   :.:.:...|.:::...:|      |.|: ..|..:.||:.:.|       .|...|.|: 
Mouse 15422 LE---EGDRVKMKTISAYAELVISPSERTDKGI-YTLTLENPVKSISGEINVNVIAPPSAPKELK 15482

  Fly  7790 ----------ISYEPIGFQSDMWSVGVICYVLLSGLSPFMG------DTDVETFSNITRADYDYD 7838
                      :::||   ..|            .|.||..|      |...:|::.:.....|.:
Mouse 15483 FSDITKDSVHLTWEP---PDD------------DGGSPLTGYVVEKRDMSRKTWTKVMDFVTDLE 15532

  Fly  7839 DEAFDCVSQEAKDFISQLLVHRK----EDRLTAQQCLAS------------KWLSQRPDDSLSNN 7887
            ....|.|  :.|:::.::....|    |...|.:....|            ||     .|..:|:
Mouse 15533 FTVPDLV--QGKEYLFKVCARNKCGPGEPAYTDEPVNMSAPATVPDPPENVKW-----RDRTANS 15590

  Fly  7888 KICT---------DKLKKFIIRR------KWQKTGN--------------------AIRALGRMA 7917
            ...|         .::|.:|:.:      ||...|.                    .::||.|..
Mouse 15591 IFLTWDPPKNDGGSRIKGYIVEKCPRGSDKWVACGEPVPDTKMEVTGLEEGKWYAYRVKALNRQG 15655

  Fly  7918 NLSVSRRNSAIAMGVLSSPRPSI-SGLGMLTTSAIGSGTSSQMTSLHEEEDDFSGEMPP------ 7975
            ....|:....| ..|.:...|.| ..:.:|....:.:||..::.:      ..:|:..|      
Mouse 15656 ASKPSKPTEEI-QAVDTQEAPEIFLDVKLLAGITVKAGTKIELPA------TVTGKPEPKITWTK 15713

  Fly  7976 ---------------VEKRTVLKLRDKSQCSERSDSG--YSECSNCSGAQETLLLSLAKSKLEAI 8023
                           |.|::.:.:.|    |:|||:|  ..|..|..|            :..|:
Mouse 15714 ADTLLKPDQRITIENVPKKSTVTITD----SKRSDTGTYIIEAVNVCG------------RATAV 15762

  Fly  8024 AKASTL----PTVVHD----TEQPVSLEL-PTKGEAIMRSDFTNTIKMRKKSLED---------- 8069
            .:.:.|    |....|    |.:...|.. |.:.:.  .|..||.:..||.:..|          
Mouse 15763 VEVNVLDKPGPPAAFDITDVTNESCLLTWNPPRDDG--GSKITNYVVERKATDSDVWHKLSSTVK 15825

  Fly  8070 ----SAAREKPRSKPQVKPLLCESKLKVSQLKDRFQVSPAPASASASASAANKPPLAYGPFKIAK 8130
                .|.:..| :|..:..:..|:...|.:     .|..||..|........ ||....|..|.|
Mouse 15826 DTNFKATKLTP-NKEYIFRVAAENMYGVGE-----PVQAAPIIAKYQFDPPG-PPTRLEPSDITK 15883

  Fly  8131 VASVGRISRTE-EPGRSGRGAPSVSG---------KGKSPQVRSMPSSPLPQRSATPTRLMSQRV 8185
            .|    ::.|. ||...| |:| ::|         ..|..:...||......|....|.....|.
Mouse 15884 DA----VTLTWCEPDDDG-GSP-ITGYWVERLDPDTDKWVRCNKMPVKDTTYRVKGLTNKKKYRF 15942

  Fly  8186 REAAERLA 8193
            |..||.||
Mouse 15943 RVLAENLA 15950

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 IG_like 51..127 CDD:214653 17/77 (22%)
Ig <69..>112 CDD:299845 12/42 (29%)
I-set 137..226 CDD:254352 27/99 (27%)
I-set 235..314 CDD:254352 23/89 (26%)
Ig_2 244..314 CDD:290606 21/80 (26%)
I-set 438..513 CDD:254352 29/183 (16%)
Ig 454..510 CDD:143165 23/164 (14%)
I-set 537..626 CDD:254352 19/88 (22%)
Ig 555..618 CDD:299845 13/62 (21%)
I-set 636..713 CDD:254352 29/86 (34%)
Ig 652..712 CDD:143165 23/69 (33%)
SMC_N <2190..2854 CDD:280601 175/897 (20%)
I-set 5300..5388 CDD:254352 24/106 (23%)
IGc2 5313..5378 CDD:197706 17/64 (27%)
IG 5412..5482 CDD:214652 17/78 (22%)
IGc2 5413..5481 CDD:197706 16/76 (21%)
I-set 5542..5627 CDD:254352 16/95 (17%)
Ig 5556..5621 CDD:143165 14/75 (19%)
Ig 5654..5721 CDD:143165 15/69 (22%)
I-set 5784..5874 CDD:254352 26/104 (25%)
IGc2 5797..5864 CDD:197706 20/69 (29%)
I-set 5887..5970 CDD:254352 23/84 (27%)
Ig 5902..5966 CDD:143165 19/65 (29%)
I-set 5997..6086 CDD:254352 19/89 (21%)
Ig 6026..6083 CDD:143165 11/57 (19%)
I-set 6097..6187 CDD:254352 27/105 (26%)
Ig 6114..6187 CDD:299845 23/88 (26%)
FN3 6216..6310 CDD:238020 13/94 (14%)
I-set 6321..6412 CDD:254352 24/90 (27%)
Ig 6328..6412 CDD:299845 24/83 (29%)
I-set 6442..6531 CDD:254352 17/99 (17%)
Ig 6459..6528 CDD:143165 13/79 (16%)
I-set 6541..6632 CDD:254352 25/92 (27%)
IGc2 6555..6622 CDD:197706 19/67 (28%)
I-set 6662..6754 CDD:254352 14/91 (15%)
Ig 6679..6751 CDD:143165 11/71 (15%)
I-set 6779..6868 CDD:254352 28/92 (30%)
IGc2 6793..6858 CDD:197706 23/65 (35%)
Ig 6938..7022 CDD:299845 19/83 (23%)
I-set 6939..7028 CDD:254352 21/88 (24%)
IG 7075..7140 CDD:214652 8/65 (12%)
Ig 7075..7140 CDD:143165 8/65 (12%)
IG 7167..7239 CDD:214652 16/126 (13%)
Ig 7173..7239 CDD:143165 15/120 (13%)
Ig 7392..7475 CDD:299845 24/82 (29%)
IG 7406..7475 CDD:214652 18/68 (26%)
FN3 7489..7588 CDD:238020 31/105 (30%)
S_TKc 7620..7876 CDD:214567 60/381 (16%)
STKc_MLCK 7626..7876 CDD:271005 60/375 (16%)
TtnNP_001372637.1 IgI_1_Titin_Z1z2-like 6..98 CDD:409566
Ig strand B 23..27 CDD:409566
Ig strand C 36..40 CDD:409566
Ig strand E 63..67 CDD:409566
Ig strand F 77..82 CDD:409566
Ig strand G 90..93 CDD:409566
IgI_2_Titin_Z1z2-like 103..193 CDD:409564
Ig strand B 121..125 CDD:409564
Ig strand C 134..138 CDD:409564
Ig strand E 159..163 CDD:409564
Ig strand F 173..178 CDD:409564
Ig strand G 186..189 CDD:409564
PRK12323 <253..>346 CDD:237057
Titin_Z 465..504 CDD:401109
Titin_Z 511..548 CDD:401109
Titin_Z 555..594 CDD:401109
Titin_Z 601..640 CDD:401109
Titin_Z 647..685 CDD:401109
Ig strand A 945..948 CDD:409353
I-set 946..1035 CDD:400151
Ig strand A' 951..955 CDD:409353
Ig strand B 963..971 CDD:409353
Ig strand C 976..981 CDD:409353
Ig strand C' 984..986 CDD:409353
Ig strand D 992..997 CDD:409353
Ig strand E 1000..1005 CDD:409353
Ig strand F 1014..1022 CDD:409353
Ig strand G 1025..1035 CDD:409353
I-set 1084..1173 CDD:400151
Ig strand A 1084..1087 CDD:409353
Ig strand A' 1090..1095 CDD:409353
Ig strand B 1100..1107 CDD:409353
Ig strand C 1114..1120 CDD:409353
Ig strand C' 1121..1124 CDD:409353
Ig strand D 1130..1137 CDD:409353
Ig strand E 1140..1150 CDD:409353
Ig strand F 1154..1162 CDD:409353
Ig strand G 1164..1173 CDD:409353
Ig 1295..1383 CDD:416386
Ig strand A' 1299..1304 CDD:409353
Ig strand B 1309..1316 CDD:409353
Ig strand C 1323..1329 CDD:409353
Ig strand C' 1330..1333 CDD:409353
Ig strand D 1339..1345 CDD:409353
Ig strand E 1348..1358 CDD:409353
Ig strand F 1362..1370 CDD:409353
Ig strand G 1372..1383 CDD:409353
Ig 1463..1553 CDD:416386
Ig strand A 1463..1466 CDD:409353
Ig strand A' 1469..1474 CDD:409353
Ig strand B 1479..1486 CDD:409353
Ig strand C 1493..1499 CDD:409353
Ig strand C' 1500..1503 CDD:409353
Ig strand D 1509..1515 CDD:409353
Ig strand E 1518..1528 CDD:409353
Ig strand F 1532..1540 CDD:409353
Ig strand G 1542..1553 CDD:409353
Ig 1562..1653 CDD:416386
Ig strand A 1562..1564 CDD:409353
Ig strand A' 1566..1572 CDD:409353
Ig strand B 1579..1586 CDD:409353
Ig strand C 1592..1597 CDD:409353
Ig strand C' 1599..1602 CDD:409353
Ig strand D 1610..1613 CDD:409353
Ig strand E 1618..1625 CDD:409353
Ig strand F 1632..1640 CDD:409353
Ig strand G 1643..1654 CDD:409353
Ig <1728..1800 CDD:416386
Ig strand C 1741..1746 CDD:409353
Ig strand C' 1749..1751 CDD:409353
Ig strand D 1757..1762 CDD:409353
Ig strand E 1765..1770 CDD:409353
Ig strand F 1779..1787 CDD:409353
Ig strand G 1790..1800 CDD:409353
I-set 1847..1935 CDD:400151
Ig strand A 1847..1849 CDD:409353
Ig strand A' 1851..1857 CDD:409353
Ig strand B 1864..1871 CDD:409353
Ig strand C 1877..1882 CDD:409353
Ig strand C' 1884..1887 CDD:409353
Ig strand E 1900..1907 CDD:409353
Ig strand F 1914..1922 CDD:409353
Ig strand G 1925..1936 CDD:409353
IgI_titin_I1-like 2084..2175 CDD:409543
Ig strand B 2101..2105 CDD:409543
Ig strand C 2114..2118 CDD:409543
Ig strand E 2140..2144 CDD:409543
Ig strand F 2154..2159 CDD:409543
Ig strand G 2167..2170 CDD:409543
Ig 2182..2268 CDD:416386
Ig strand A 2184..2186 CDD:409353
Ig strand A' 2189..2193 CDD:409353
Ig strand B 2197..2203 CDD:409353
Ig strand C 2210..2215 CDD:409353
Ig strand C' 2218..2221 CDD:409353
Ig strand D 2226..2231 CDD:409353
Ig strand E 2234..2239 CDD:409353
Ig strand F 2248..2253 CDD:409353
Ig 2274..2358 CDD:416386
Ig strand A' 2279..2284 CDD:409353
Ig strand B 2289..2296 CDD:409353
Ig strand C 2299..2308 CDD:409353
Ig strand C' 2309..2312 CDD:409353
Ig strand D 2318..2324 CDD:409353
Ig strand E 2326..2336 CDD:409353
Ig 2363..2434 CDD:416386
Ig strand A' 2368..2373 CDD:409353
Ig strand B 2378..2385 CDD:409353
Ig strand C 2391..2397 CDD:409353
Ig strand C' 2398..2401 CDD:409353
Ig strand D 2407..2413 CDD:409353
Ig strand E 2415..2425 CDD:409353
Ig 2453..2536 CDD:416386
Ig strand A' 2460..2463 CDD:409353
Ig strand B 2467..2473 CDD:409353
Ig strand C 2481..2486 CDD:409353
Ig strand C' 2489..2492 CDD:409353
Ig strand D 2497..2502 CDD:409353
Ig strand E 2505..2510 CDD:409353
Ig strand F 2519..2525 CDD:409353
Ig strand G 2528..2536 CDD:409353
Ig 2540..2623 CDD:416386
Ig strand C 2568..2573 CDD:409353
Ig strand C' 2576..2579 CDD:409353
Ig strand D 2584..2589 CDD:409353
Ig strand E 2592..2597 CDD:409353
Ig strand F 2606..2612 CDD:409353
Ig strand G 2615..2623 CDD:409353
Ig 2628..2710 CDD:416386
Ig strand C 2655..2660 CDD:409353
Ig strand C' 2663..2666 CDD:409353
Ig strand D 2671..2676 CDD:409353
Ig strand E 2679..2684 CDD:409353
Ig strand F 2693..2699 CDD:409353
Ig strand G 2702..2710 CDD:409353
Ig 2714..2798 CDD:416386
Ig strand A' 2717..2723 CDD:409353
Ig strand B 2730..2737 CDD:409353
Ig strand C 2743..2748 CDD:409353
Ig strand C' 2750..2753 CDD:409353
Ig strand D 2758..2762 CDD:409353
Ig strand E 2767..2774 CDD:409353
Ig strand G 2788..2799 CDD:409353
Ig 2802..2885 CDD:416386
Ig strand A' 2807..2812 CDD:409353
Ig strand B 2817..2824 CDD:409353
Ig strand C 2831..2836 CDD:409353
Ig strand C' 2837..2840 CDD:409353
Ig strand D 2846..2851 CDD:409353
Ig strand E 2854..2864 CDD:409353
Ig strand G 2875..2885 CDD:409353
Ig 2889..2972 CDD:416386
Ig strand A' 2892..2898 CDD:409353
Ig strand B 2905..2912 CDD:409353
Ig strand C 2918..2922 CDD:409353
Ig strand C' 2924..2927 CDD:409353
Ig strand D 2932..2936 CDD:409353
Ig strand E 2941..2948 CDD:409353
Ig strand F 2955..2963 CDD:409353
Ig 2977..3059 CDD:416386
Ig strand A' 2979..2985 CDD:409353
Ig strand B 2992..3001 CDD:409353
Ig strand C 3004..3009 CDD:409353
Ig strand C' 3011..3014 CDD:409353
Ig strand D 3019..3023 CDD:409353
Ig strand E 3028..3035 CDD:409353
Ig strand G 3049..3060 CDD:409353
I-set 3065..3148 CDD:400151
Ig strand A' 3068..3074 CDD:409353
Ig strand B 3081..3088 CDD:409353
Ig strand C 3093..3098 CDD:409353
Ig strand C' 3100..3103 CDD:409353
Ig strand E 3117..3124 CDD:409353
Ig strand G 3138..3149 CDD:409353
Ig 3159..3239 CDD:416386
Ig strand A' 3161..3165 CDD:409353
Ig strand B 3169..3175 CDD:409353
Ig strand C 3182..3187 CDD:409353
Ig strand C' 3190..3193 CDD:409353
Ig strand D 3198..3203 CDD:409353
Ig strand E 3206..3213 CDD:409353
Ig strand F 3222..3228 CDD:409353
Ig strand G 3231..3239 CDD:409353
Ig 3245..3335 CDD:416386
Ig strand A 3245..3247 CDD:409353
Ig strand A' 3249..3255 CDD:409353
Ig strand B 3262..3269 CDD:409353
Ig strand C 3275..3280 CDD:409353
Ig strand C' 3282..3285 CDD:409353
Ig strand D 3290..3294 CDD:409353
Ig strand E 3299..3306 CDD:409353
Ig strand F 3313..3321 CDD:409353
Ig strand G 3324..3335 CDD:409353
Ig strand A 3350..3353 CDD:409353
I-set 3351..3437 CDD:400151
Ig strand A' 3356..3360 CDD:409353
Ig strand B 3368..3376 CDD:409353
Ig strand C 3380..3385 CDD:409353
Ig strand C' 3388..3390 CDD:409353
Ig strand D 3396..3401 CDD:409353
Ig strand E 3404..3409 CDD:409353
Ig strand F 3418..3426 CDD:409353
Ig strand G 3429..3437 CDD:409353
I-set 3471..3562 CDD:400151
Ig strand A 3471..3473 CDD:409353
Ig strand A' 3475..3481 CDD:409353
Ig strand B 3488..3495 CDD:409353
Ig strand C 3501..3506 CDD:409353
Ig strand C' 3508..3511 CDD:409353
Ig strand D 3518..3522 CDD:409353
Ig strand E 3527..3534 CDD:409353
Ig strand F 3541..3549 CDD:409353
Ig strand G 3552..3562 CDD:409353
I-set 3634..3721 CDD:400151
Ig strand A 3634..3637 CDD:409353
Ig strand A' 3640..3645 CDD:409353
Ig strand B 3650..3657 CDD:409353
Ig strand C 3664..3670 CDD:409353
Ig strand C' 3671..3674 CDD:409353
Ig strand D 3679..3685 CDD:409353
Ig strand E 3688..3698 CDD:409353
Ig strand F 3702..3710 CDD:409353
Ig strand G 3712..3723 CDD:409353
I-set 3750..3840 CDD:400151
Ig strand B 3765..3774 CDD:409353
Ig strand C 3779..3785 CDD:409353
Ig strand C' 3788..3790 CDD:409353
Ig strand D 3796..3801 CDD:409353
Ig strand E 3804..3812 CDD:409353
Ig strand F 3820..3827 CDD:409353
Ig strand G 3830..3840 CDD:409353
Ig 4376..4463 CDD:416386
Ig strand A 4376..4379 CDD:409353
Ig strand A' 4382..4387 CDD:409353
Ig strand B 4392..4399 CDD:409353
Ig strand C 4404..4410 CDD:409353
Ig strand C' 4411..4414 CDD:409353
Ig strand D 4420..4426 CDD:409353
Ig strand E 4429..4438 CDD:409353
Ig strand F 4442..4450 CDD:409353
Ig strand G 4452..4463 CDD:409353
I-set 4469..4558 CDD:400151
Ig strand A 4469..4471 CDD:409353
Ig strand A' 4473..4479 CDD:409353
Ig strand B 4486..4493 CDD:409353
Ig strand C 4499..4504 CDD:409353
Ig strand C' 4506..4509 CDD:409353
Ig strand D 4514..4518 CDD:409353
Ig strand E 4523..4530 CDD:409353
Ig strand F 4537..4545 CDD:409353
Ig strand G 4548..4558 CDD:409353
I-set 4564..4653 CDD:400151
Ig strand A 4564..4567 CDD:409353
Ig strand A' 4570..4575 CDD:409353
Ig strand B 4580..4587 CDD:409353
Ig strand C 4594..4600 CDD:409353
Ig strand C' 4601..4604 CDD:409353
Ig strand D 4609..4615 CDD:409353
Ig strand E 4618..4628 CDD:409353
Ig strand F 4632..4640 CDD:409353
Ig strand G 4642..4653 CDD:409353
Ig 4657..4730 CDD:416386
Ig strand B 4674..4678 CDD:409353
Ig strand C 4687..4691 CDD:409353
Ig strand E 4712..4716 CDD:409353
Ig strand F 4726..4730 CDD:409353
I-set 4750..4840 CDD:400151
Ig strand B 4768..4772 CDD:409353
Ig strand C 4781..4785 CDD:409353
Ig strand E 4806..4810 CDD:409353
Ig strand F 4820..4825 CDD:409353
I-set 4844..4930 CDD:400151
Ig strand B 4861..4865 CDD:409353
Ig strand C 4874..4878 CDD:409353
Ig strand E 4899..4903 CDD:409353
Ig strand F 4913..4918 CDD:409353
I-set 4937..5026 CDD:400151
Ig strand A 4937..4939 CDD:409353
Ig strand A' 4942..4947 CDD:409353
Ig strand B 4954..4962 CDD:409353
Ig strand C 4967..4971 CDD:409353
Ig strand C' 4975..4977 CDD:409353
Ig strand D 4982..4988 CDD:409353
Ig strand E 4991..4996 CDD:409353
Ig strand F 5005..5013 CDD:409353
Ig strand G 5016..5027 CDD:409353
I-set 5039..5119 CDD:400151
Ig strand B 5047..5051 CDD:409353
Ig strand C 5060..5064 CDD:409353
Ig strand E 5085..5089 CDD:409353
Ig strand F 5099..5104 CDD:409353
Ig strand G 5113..5116 CDD:409353
I-set 5126..5215 CDD:400151
Ig strand B 5144..5147 CDD:409353
Ig strand C 5156..5160 CDD:409353
Ig strand E 5181..5185 CDD:409353
Ig strand F 5195..5200 CDD:409353
Ig strand G 5209..5212 CDD:409353
Ig strand A 5218..5221 CDD:409353
I-set 5219..5308 CDD:400151
Ig strand A' 5224..5228 CDD:409353
Ig strand B 5236..5244 CDD:409353
Ig strand C 5249..5254 CDD:409353
Ig strand C' 5257..5259 CDD:409353
Ig strand D 5265..5270 CDD:409353
Ig strand E 5273..5278 CDD:409353
Ig strand F 5287..5295 CDD:409353
Ig strand G 5298..5308 CDD:409353
I-set 5314..5402 CDD:400151
Ig strand A' 5318..5323 CDD:409353
Ig strand B 5329..5336 CDD:409353
Ig strand C 5343..5349 CDD:409353
Ig strand C' 5350..5353 CDD:409353
Ig strand D 5359..5365 CDD:409353
Ig strand E 5368..5377 CDD:409353
Ig strand F 5381..5389 CDD:409353
I-set 5406..5494 CDD:400151
Ig strand B 5423..5427 CDD:409353
Ig strand C 5436..5440 CDD:409353
Ig strand E 5461..5465 CDD:409353
Ig strand F 5475..5480 CDD:409353
Ig 5499..5588 CDD:416386
Ig strand C 5529..5533 CDD:409353
Ig strand E 5554..5558 CDD:409353
Ig strand F 5568..5573 CDD:409353
Ig 5600..5681 CDD:416386
Ig strand A 5601..5604 CDD:409353
Ig strand B 5609..5615 CDD:409353
Ig strand C 5621..5627 CDD:409353
Ig strand D 5639..5644 CDD:409353
Ig strand E 5645..5651 CDD:409353
Ig strand F 5660..5668 CDD:409353
Ig strand G 5671..5681 CDD:409353
I-set 5688..5777 CDD:400151
Ig strand C 5718..5722 CDD:409353
Ig strand E 5743..5747 CDD:409353
Ig strand F 5757..5762 CDD:409353
Ig strand A 5780..5783 CDD:409353
Ig 5781..5870 CDD:416386
Ig strand A' 5786..5790 CDD:409353
Ig strand B 5798..5806 CDD:409353
Ig strand C 5811..5816 CDD:409353
Ig strand C' 5819..5821 CDD:409353
Ig strand D 5827..5832 CDD:409353
Ig strand E 5835..5840 CDD:409353
Ig strand F 5849..5857 CDD:409353
Ig strand G 5860..5870 CDD:409353
I-set 5874..5964 CDD:400151
Ig strand B 5893..5896 CDD:409353
Ig strand C 5905..5909 CDD:409353
Ig strand E 5930..5934 CDD:409353
Ig strand F 5944..5949 CDD:409353
Ig strand G 5957..5960 CDD:409353
I-set 5968..6056 CDD:400151
Ig strand A 5968..5970 CDD:409353
Ig strand A' 5972..5978 CDD:409353
Ig strand B 5985..5992 CDD:409353
Ig strand C 5998..6003 CDD:409353
Ig strand C' 6005..6008 CDD:409353
Ig strand D 6013..6017 CDD:409353
Ig strand E 6022..6029 CDD:409353
Ig strand F 6036..6044 CDD:409353
Ig strand G 6047..6058 CDD:409353
I-set 6061..6150 CDD:400151
Ig strand B 6078..6082 CDD:409353
Ig strand C 6091..6095 CDD:409353
Ig strand E 6116..6120 CDD:409353
Ig strand F 6130..6135 CDD:409353
I-set 6155..6243 CDD:400151
Ig strand B 6171..6175 CDD:409353
Ig strand C 6184..6188 CDD:409353
Ig strand E 6209..6213 CDD:409353
Ig strand F 6223..6228 CDD:409353
Ig strand A 6249..6252 CDD:409353
I-set 6250..6339 CDD:400151
Ig strand A' 6255..6259 CDD:409353
Ig strand B 6267..6275 CDD:409353
Ig strand C 6280..6285 CDD:409353
Ig strand C' 6288..6290 CDD:409353
Ig strand D 6296..6301 CDD:409353
Ig strand E 6304..6309 CDD:409353
Ig strand F 6318..6326 CDD:409353
Ig strand G 6329..6339 CDD:409353
Ig strand A 6342..6345 CDD:409353
I-set 6343..6432 CDD:400151
Ig strand A' 6348..6352 CDD:409353
Ig strand B 6360..6368 CDD:409353
Ig strand C 6373..6378 CDD:409353
Ig strand C' 6381..6383 CDD:409353
Ig strand D 6389..6394 CDD:409353
Ig strand E 6397..6402 CDD:409353
Ig strand F 6411..6419 CDD:409353
Ig strand G 6422..6432 CDD:409353
I-set 6436..6526 CDD:400151
Ig strand A 6436..6439 CDD:409353
Ig strand A' 6442..6447 CDD:409353
Ig strand B 6453..6460 CDD:409353
Ig strand C 6467..6473 CDD:409353
Ig strand C' 6474..6477 CDD:409353
Ig strand D 6483..6489 CDD:409353
Ig strand E 6491..6501 CDD:409353
Ig strand F 6505..6513 CDD:409353
Ig strand G 6515..6526 CDD:409353
I-set 6530..6618 CDD:400151
Ig strand B 6547..6551 CDD:409353
Ig strand C 6560..6564 CDD:409353
Ig strand E 6585..6589 CDD:409353
Ig strand F 6599..6604 CDD:409353
Ig strand A 6622..6626 CDD:409353
I-set 6623..6713 CDD:400151
Ig strand A' 6631..6635 CDD:409353
Ig strand B 6639..6648 CDD:409353
Ig strand C 6652..6658 CDD:409353
Ig strand C' 6661..6664 CDD:409353
Ig strand D 6670..6675 CDD:409353
Ig strand E 6679..6684 CDD:409353
Ig strand F 6692..6700 CDD:409353
Ig strand G 6703..6713 CDD:409353
I-set 6718..6806 CDD:400151
Ig strand C 6747..6751 CDD:409353
Ig strand E 6772..6776 CDD:409353
Ig strand F 6786..6791 CDD:409353
Ig strand G 6800..6803 CDD:409353
I-set 6813..6902 CDD:400151
Ig strand C 6843..6847 CDD:409353
Ig strand E 6868..6872 CDD:409353
Ig strand F 6882..6887 CDD:409353
Ig strand A 6905..6908 CDD:409353
I-set 6906..6995 CDD:400151
Ig strand A' 6914..6917 CDD:409353
Ig strand B 6922..6930 CDD:409353
Ig strand C 6936..6940 CDD:409353
Ig strand C' 6943..6946 CDD:409353
Ig strand D 6951..6957 CDD:409353
Ig strand E 6961..6966 CDD:409353
Ig strand F 6974..6982 CDD:409353
Ig strand G 6985..6995 CDD:409353
I-set 7001..7086 CDD:400151
Ig strand B 7016..7020 CDD:409353
Ig strand C 7029..7033 CDD:409353
Ig strand E 7054..7058 CDD:409353
Ig strand F 7068..7073 CDD:409353
I-set 7092..7173 CDD:400151
Ig strand B 7109..7113 CDD:409353
Ig strand C 7122..7126 CDD:409353
Ig strand E 7147..7151 CDD:409353
Ig strand F 7161..7166 CDD:409353
Ig strand G 7175..7178 CDD:409353
I-set 7188..7276 CDD:400151
Ig strand B 7205..7209 CDD:409353
Ig strand C 7218..7222 CDD:409353
Ig strand E 7243..7247 CDD:409353
Ig strand F 7257..7262 CDD:409353
I-set 7284..7373 CDD:400151 23/98 (23%)
Ig strand A 7284..7287 CDD:409353 1/2 (50%)
Ig strand A' 7290..7295 CDD:409353 1/4 (25%)
Ig strand B 7300..7307 CDD:409353 2/6 (33%)
Ig strand C 7314..7320 CDD:409353 2/5 (40%)
Ig strand C' 7321..7324 CDD:409353 0/2 (0%)
Ig strand D 7330..7336 CDD:409353 2/5 (40%)
Ig strand E 7339..7348 CDD:409353 2/8 (25%)
Ig strand F 7352..7360 CDD:409353 4/10 (40%)
Ig strand G 7362..7373 CDD:409353 2/10 (20%)
Ig strand A 7376..7379 CDD:409353 2/2 (100%)
I-set 7377..7467 CDD:400151 27/99 (27%)
Ig strand A' 7382..7386 CDD:409353 1/3 (33%)
Ig strand B 7395..7403 CDD:409353 2/7 (29%)
Ig strand C 7408..7413 CDD:409353 2/4 (50%)
Ig strand C' 7416..7418 CDD:409353 0/1 (0%)
Ig strand D 7424..7429 CDD:409353 1/4 (25%)
Ig strand E 7432..7437 CDD:409353 1/4 (25%)
Ig strand F 7446..7454 CDD:409353 2/7 (29%)
Ig strand G 7457..7467 CDD:409353 4/9 (44%)
Ig strand A 7470..7473 CDD:409353 2/7 (29%)
I-set 7471..7559 CDD:400151 25/110 (23%)
Ig strand A' 7476..7480 CDD:409353 0/3 (0%)
Ig strand B 7488..7496 CDD:409353 3/7 (43%)
Ig strand C 7501..7506 CDD:409353 1/4 (25%)
Ig strand C' 7509..7511 CDD:409353 1/1 (100%)
Ig strand D 7517..7522 CDD:409353 2/4 (50%)
Ig strand E 7525..7530 CDD:409353 0/4 (0%)
Ig strand F 7539..7547 CDD:409353 4/7 (57%)
Ig strand A 7563..7567 CDD:409353 2/3 (67%)
I-set 7564..7654 CDD:400151 26/97 (27%)
Ig strand A' 7572..7576 CDD:409353 2/3 (67%)
Ig strand B 7580..7589 CDD:409353 4/10 (40%)
Ig strand C 7593..7599 CDD:409353 3/5 (60%)
Ig strand C' 7602..7605 CDD:409353 1/2 (50%)
Ig strand D 7611..7616 CDD:409353 1/4 (25%)
Ig strand E 7620..7625 CDD:409353 0/4 (0%)
Ig strand F 7633..7641 CDD:409353 2/7 (29%)
Ig strand G 7644..7660 CDD:409353 4/15 (27%)
Ig strand A 7657..7664 CDD:409353 1/6 (17%)
I-set 7660..7747 CDD:400151 20/91 (22%)
Ig strand A' 7665..7670 CDD:409353 1/9 (11%)
Ig strand B 7675..7683 CDD:409353 3/7 (43%)
Ig strand C 7687..7693 CDD:409353 2/5 (40%)
Ig strand C' 7695..7697 CDD:409353 1/1 (100%)
Ig strand D 7703..7709 CDD:409353 1/5 (20%)
Ig strand E 7712..7718 CDD:409353 1/5 (20%)
Ig strand F 7727..7734 CDD:409353 0/6 (0%)
Ig strand A 7753..7756 CDD:409353 0/2 (0%)
I-set 7754..7843 CDD:400151 10/88 (11%)
Ig strand A' 7759..7763 CDD:409353 0/3 (0%)
Ig strand B 7771..7779 CDD:409353 0/7 (0%)
Ig strand C 7784..7789 CDD:409353 0/4 (0%)
Ig strand C' 7792..7794 CDD:409353 0/1 (0%)
Ig strand D 7800..7805 CDD:409353 0/4 (0%)
Ig strand E 7808..7813 CDD:409353 0/4 (0%)
Ig strand F 7822..7830 CDD:409353 4/7 (57%)
Ig strand G 7833..7843 CDD:409353 5/9 (56%)
Ig strand A 7846..7849 CDD:409353 0/2 (0%)
I-set 7847..7936 CDD:400151 7/88 (8%)
Ig strand A' 7852..7856 CDD:409353 0/3 (0%)
Ig strand B 7864..7872 CDD:409353 0/7 (0%)
Ig strand C 7877..7882 CDD:409353 0/4 (0%)
Ig strand C' 7885..7887 CDD:409353 0/1 (0%)
Ig strand D 7893..7898 CDD:409353 0/4 (0%)
Ig strand E 7901..7906 CDD:409353 1/4 (25%)
Ig strand F 7915..7923 CDD:409353 3/7 (43%)
Ig strand G 7926..7936 CDD:409353 0/9 (0%)
Ig 7942..8029 CDD:416386 19/87 (22%)
Ig strand A' 7944..7950 CDD:409353 1/5 (20%)
Ig strand B 7957..7964 CDD:409353 0/6 (0%)
Ig strand C 7970..7975 CDD:409353 2/4 (50%)
Ig strand C' 7977..7980 CDD:409353 1/2 (50%)
Ig strand D 7985..7989 CDD:409353 0/3 (0%)
Ig strand E 7994..8001 CDD:409353 2/7 (29%)
Ig strand F 8008..8016 CDD:409353 2/7 (29%)
Ig strand G 8019..8029 CDD:409353 2/9 (22%)
I-set 8033..8122 CDD:400151 30/108 (28%)
Ig strand B 8050..8054 CDD:409353 1/3 (33%)
Ig strand C 8063..8067 CDD:409353 0/3 (0%)
Ig strand E 8088..8092 CDD:409353 0/3 (0%)
Ig strand F 8102..8107 CDD:409353 3/4 (75%)
Ig strand G 8116..8119 CDD:409353 2/2 (100%)
I-set 8129..8217 CDD:400151 23/109 (21%)
Ig strand B 8146..8150 CDD:409353 1/12 (8%)
Ig strand C 8159..8163 CDD:409353 2/3 (67%)
Ig strand E 8184..8188 CDD:409353 1/3 (33%)
Ig strand F 8198..8203 CDD:409353 1/4 (25%)
I-set 8225..8314 CDD:400151 19/112 (17%)
Ig strand A 8225..8228 CDD:409353 1/12 (8%)
Ig strand A' 8231..8236 CDD:409353 1/5 (20%)
Ig strand B 8241..8248 CDD:409353 1/6 (17%)
Ig strand C 8255..8261 CDD:409353 0/5 (0%)
Ig strand C' 8262..8265 CDD:409353 1/10 (10%)
Ig strand D 8271..8277 CDD:409353 2/5 (40%)
Ig strand E 8279..8289 CDD:409353 1/9 (11%)
Ig strand F 8293..8301 CDD:409353 2/10 (20%)
Ig strand G 8303..8314 CDD:409353 3/10 (30%)
Ig 8318..8395 CDD:416386 17/91 (19%)
Ig strand C 8349..8353 CDD:409353 2/3 (67%)
Ig strand E 8374..8378 CDD:409353 0/3 (0%)
Ig strand F 8388..8393 CDD:409353 0/4 (0%)
Ig strand A 8411..8414 CDD:409353 0/2 (0%)
I-set 8412..8500 CDD:400151 16/98 (16%)
Ig strand A' 8417..8421 CDD:409353 0/3 (0%)
Ig strand B 8429..8437 CDD:409353 0/7 (0%)
Ig strand C 8442..8447 CDD:409353 1/4 (25%)
Ig strand C' 8450..8452 CDD:409353 1/1 (100%)
Ig strand D 8458..8463 CDD:409353 0/4 (0%)
Ig strand E 8466..8471 CDD:409353 2/4 (50%)
Ig strand F 8480..8488 CDD:409353 2/7 (29%)
Ig strand A 8504..8507 CDD:409353 0/2 (0%)
I-set 8505..8595 CDD:400151 16/120 (13%)
Ig strand A' 8510..8514 CDD:409353 0/3 (0%)
Ig strand B 8522..8530 CDD:409353 1/7 (14%)
Ig strand C 8535..8540 CDD:409353 1/5 (20%)
Ig strand C' 8543..8545 CDD:409353 0/1 (0%)
Ig strand D 8552..8557 CDD:409353 0/4 (0%)
Ig strand E 8560..8565 CDD:409353 2/5 (40%)
Ig strand F 8574..8582 CDD:409353 3/18 (17%)
Ig strand G 8585..8595 CDD:409353 1/19 (5%)
I-set 8601..8688 CDD:400151 21/98 (21%)
Ig strand B 8617..8620 CDD:409353 0/2 (0%)
Ig strand C 8629..8633 CDD:409353 0/3 (0%)
Ig strand E 8654..8658 CDD:409353 1/3 (33%)
Ig strand F 8668..8673 CDD:409353 1/5 (20%)
Ig strand A 8694..8697 CDD:409353 0/2 (0%)
I-set 8695..8784 CDD:400151 19/100 (19%)
Ig strand A' 8700..8704 CDD:409353 2/13 (15%)
Ig strand B 8712..8720 CDD:409353 0/7 (0%)
Ig strand C 8725..8730 CDD:409353 0/4 (0%)
Ig strand C' 8733..8735 CDD:409353 0/1 (0%)
Ig strand D 8741..8746 CDD:409353 0/4 (0%)
Ig strand E 8749..8754 CDD:409353 1/4 (25%)
Ig strand F 8763..8771 CDD:409353 1/7 (14%)
Ig strand G 8774..8784 CDD:409353 2/9 (22%)
I-set 8788..8877 CDD:400151 21/128 (16%)
Ig strand B 8805..8809 CDD:409353 0/3 (0%)
Ig strand C 8818..8822 CDD:409353 0/17 (0%)
Ig strand E 8843..8847 CDD:409353 1/3 (33%)
Ig strand F 8857..8862 CDD:409353 1/4 (25%)
I-set 8883..8967 CDD:400151 15/88 (17%)
Ig strand A 8890..8893 CDD:409353 0/2 (0%)
Ig strand B 8898..8904 CDD:409353 0/5 (0%)
Ig strand C 8910..8916 CDD:409353 0/5 (0%)
Ig strand D 8928..8933 CDD:409353 0/4 (0%)
Ig strand E 8934..8940 CDD:409353 1/5 (20%)
Ig strand F 8949..8957 CDD:409353 1/7 (14%)
I-set 8974..9063 CDD:400151 17/103 (17%)
Ig strand B 8991..8995 CDD:409353 1/3 (33%)
Ig strand C 9004..9008 CDD:409353 1/3 (33%)
Ig strand E 9029..9033 CDD:409353 0/3 (0%)
Ig strand F 9043..9048 CDD:409353 0/4 (0%)
Ig strand G 9057..9060 CDD:409353 2/2 (100%)
Ig strand A 9069..9072 CDD:409353 0/2 (0%)
I-set 9070..9158 CDD:400151 22/97 (23%)
Ig strand A' 9075..9079 CDD:409353 1/3 (33%)
Ig strand B 9087..9095 CDD:409353 4/8 (50%)
Ig strand C 9100..9105 CDD:409353 1/7 (14%)
Ig strand C' 9108..9110 CDD:409353 0/1 (0%)
Ig strand D 9116..9121 CDD:409353 1/4 (25%)
Ig strand E 9124..9129 CDD:409353 0/4 (0%)
Ig strand F 9138..9146 CDD:409353 1/7 (14%)
Ig strand G 9149..9159 CDD:409353 0/9 (0%)
I-set 9166..9255 CDD:400151 18/100 (18%)
Ig strand B 9183..9187 CDD:409353 2/4 (50%)
Ig strand C 9196..9200 CDD:409353 2/3 (67%)
Ig strand E 9221..9225 CDD:409353 0/3 (0%)
Ig strand F 9235..9240 CDD:409353 2/4 (50%)
Ig strand G 9248..9251 CDD:409353 0/2 (0%)
Ig 9262..9352 CDD:416386 23/136 (17%)
Ig strand A 9262..9264 CDD:409353 0/1 (0%)
Ig strand A' 9266..9271 CDD:409353 1/4 (25%)
Ig strand B 9280..9287 CDD:409353 3/14 (21%)
Ig strand C 9293..9298 CDD:409353 1/4 (25%)
Ig strand C' 9300..9303 CDD:409353 1/2 (50%)
Ig strand D 9308..9312 CDD:409353 0/3 (0%)
Ig strand E 9317..9324 CDD:409353 1/6 (17%)
Ig strand F 9331..9339 CDD:409353 1/13 (8%)
Ig strand G 9342..9353 CDD:409353 4/10 (40%)
Ig strand A 9358..9361 CDD:409353 0/2 (0%)
I-set 9359..9448 CDD:400151 21/109 (19%)
Ig strand A' 9364..9368 CDD:409353 0/3 (0%)
Ig strand B 9376..9384 CDD:409353 2/7 (29%)
Ig strand C 9389..9394 CDD:409353 1/4 (25%)
Ig strand C' 9397..9399 CDD:409353 0/1 (0%)
Ig strand D 9405..9410 CDD:409353 0/4 (0%)
Ig strand E 9413..9418 CDD:409353 2/5 (40%)
Ig strand F 9427..9435 CDD:409353 0/7 (0%)
Ig strand G 9438..9448 CDD:409353 1/9 (11%)
I-set 9469..9557 CDD:400151 11/87 (13%)
Ig strand A' 9471..9477 CDD:409353 3/5 (60%)
Ig strand B 9484..9491 CDD:409353 1/6 (17%)
Ig strand C 9497..9502 CDD:409353 0/4 (0%)
Ig strand D 9513..9517 CDD:409353 0/3 (0%)
Ig strand E 9522..9529 CDD:409353 2/6 (33%)
Ig strand F 9536..9544 CDD:409353 0/7 (0%)
Ig strand G 9547..9557 CDD:409353 1/9 (11%)
THB 9591..9621 CDD:408162 3/29 (10%)
Ig 9675..9755 CDD:416386 15/82 (18%)
Ig strand C 9700..9704 CDD:409353 1/3 (33%)
Ig strand E 9725..9729 CDD:409353 0/3 (0%)
Ig 9758..9840 CDD:416386 17/85 (20%)
Ig strand A 9758..9761 CDD:409353 0/2 (0%)
Ig strand A' 9764..9769 CDD:409353 1/7 (14%)
Ig strand B 9774..9781 CDD:409353 3/7 (43%)
Ig strand C 9787..9793 CDD:409353 0/5 (0%)
Ig strand C' 9794..9797 CDD:409353 0/2 (0%)
Ig strand D 9803..9808 CDD:409353 0/4 (0%)
Ig strand E 9811..9821 CDD:409353 3/9 (33%)
Ig strand G 9831..9842 CDD:409353 2/10 (20%)
I-set 9848..9934 CDD:400151 12/86 (14%)
Ig strand A' 9851..9857 CDD:409353 0/5 (0%)
Ig strand B 9864..9871 CDD:409353 2/6 (33%)
Ig strand C 9876..9881 CDD:409353 2/4 (50%)
Ig strand C' 9883..9886 CDD:409353 0/2 (0%)
Ig strand D 9891..9895 CDD:409353 0/3 (0%)
Ig strand E 9900..9907 CDD:409353 0/6 (0%)
Ig strand F 9914..9923 CDD:409353 0/8 (0%)
PTZ00121 <10208..10736 CDD:173412 144/594 (24%)
PPAK 11006..11030 CDD:397106 9/25 (36%)
PPAK 11062..11086 CDD:397106 6/26 (23%)
PPAK 11088..11114 CDD:397106 9/25 (36%)
PPAK 11264..11288 CDD:397106 7/23 (30%)
PTZ00449 <11550..11841 CDD:185628 76/296 (26%)
PHA03247 <11702..12305 CDD:223021 147/642 (23%)
PspC_subgroup_2 <12149..12512 CDD:411408 83/383 (22%)
PPAK 12629..12654 CDD:397106 6/24 (25%)
Ig 13103..13194 CDD:416386 23/91 (25%)
Ig strand B 13123..13127 CDD:409353 0/3 (0%)
Ig strand C 13136..13139 CDD:409353 0/2 (0%)
Ig strand E 13160..13164 CDD:409353 1/3 (33%)
Ig strand F 13174..13179 CDD:409353 2/4 (50%)
Ig_3 13207..13275 CDD:404760 15/79 (19%)
IG_like 13300..>13364 CDD:214653 13/95 (14%)
Ig 13475..13557 CDD:416386 9/81 (11%)
Ig strand A' 13481..13484 CDD:409353 0/2 (0%)
Ig strand B 13488..13497 CDD:409353 0/8 (0%)
Ig strand C' 13509..13511 CDD:409353 0/1 (0%)
Ig strand D 13517..13522 CDD:409353 0/4 (0%)
Ig strand E 13525..13532 CDD:409353 1/6 (17%)
Ig strand A 13561..13563 CDD:409353 0/1 (0%)
Ig 13562..13645 CDD:416386 27/97 (28%)
Ig strand A' 13565..13571 CDD:409353 2/5 (40%)
Ig strand B 13578..13585 CDD:409353 2/6 (33%)
Ig strand C 13590..13595 CDD:409353 2/4 (50%)
Ig strand C' 13597..13600 CDD:409353 0/2 (0%)
Ig strand D 13605..13609 CDD:409353 2/3 (67%)
Ig strand E 13614..13621 CDD:409353 3/6 (50%)
Ig strand F 13628..13636 CDD:409353 0/7 (0%)
Ig 13650..13733 CDD:416386 23/87 (26%)
Ig strand B 13666..13672 CDD:409353 2/5 (40%)
Ig strand C 13678..13683 CDD:409353 2/7 (29%)
Ig strand C' 13686..13689 CDD:409353 1/2 (50%)
Ig strand D 13694..13699 CDD:409353 1/6 (17%)
Ig strand E 13702..13707 CDD:409353 0/4 (0%)
Ig strand F 13716..13722 CDD:409353 3/5 (60%)
Ig strand G 13725..13733 CDD:409353 0/7 (0%)
Ig 13739..13822 CDD:416386 21/104 (20%)
Ig strand B 13755..13762 CDD:409353 1/6 (17%)
Ig strand C 13767..13772 CDD:409353 1/4 (25%)
Ig strand C' 13774..13777 CDD:409353 0/2 (0%)
Ig strand D 13782..13786 CDD:409353 0/3 (0%)
Ig strand E 13791..13798 CDD:409353 1/6 (17%)
Ig strand F 13805..13813 CDD:409353 2/7 (29%)
Ig strand G 13814..13823 CDD:409353 4/18 (22%)
Ig strand A 13826..13828 CDD:409353 1/1 (100%)
Ig 13829..13903 CDD:416386 24/79 (30%)
Ig strand A' 13830..13837 CDD:409353 1/7 (14%)
Ig strand B 13844..13851 CDD:409353 0/6 (0%)
Ig strand C 13856..13861 CDD:409353 2/4 (50%)
Ig strand C' 13863..13866 CDD:409353 1/2 (50%)
Ig strand D 13871..13875 CDD:409353 2/5 (40%)
Ig strand E 13880..13887 CDD:409353 2/6 (33%)
Ig strand F 13894..13902 CDD:409353 2/7 (29%)
Ig strand A 13916..13918 CDD:409353 0/1 (0%)
Ig 13917..14000 CDD:416386 20/129 (16%)
Ig strand A' 13920..13926 CDD:409353 1/5 (20%)
Ig strand B 13933..13940 CDD:409353 0/10 (0%)
Ig strand C 13946..13950 CDD:409353 1/3 (33%)
Ig strand D 13960..13964 CDD:409353 0/3 (0%)
Ig strand E 13969..13976 CDD:409353 3/8 (38%)
Ig strand F 13983..13991 CDD:409353 3/9 (33%)
Ig 14005..14089 CDD:416386 29/106 (27%)
Ig strand A' 14010..14014 CDD:409353 0/3 (0%)
Ig strand B 14022..14030 CDD:409353 3/7 (43%)
Ig strand C 14035..14039 CDD:409353 2/3 (67%)
Ig strand C' 14042..14044 CDD:409353 0/1 (0%)
Ig strand D 14050..14055 CDD:409353 2/4 (50%)
Ig strand E 14058..14063 CDD:409353 1/4 (25%)
Ig strand G 14079..14089 CDD:409353 3/9 (33%)
Ig 14095..14178 CDD:416386 11/85 (13%)
Ig 14186..14257 CDD:416386 13/71 (18%)
Ig strand A' 14192..14195 CDD:409353 0/2 (0%)
Ig strand B 14199..14205 CDD:409353 0/5 (0%)
Ig strand C 14212..14217 CDD:409353 2/5 (40%)
Ig strand C' 14220..14223 CDD:409353 0/2 (0%)
Ig strand D 14228..14233 CDD:409353 0/4 (0%)
Ig strand E 14236..14241 CDD:409353 2/4 (50%)
Ig strand F 14250..14256 CDD:409353 1/5 (20%)
Ig strand G 14259..14267 CDD:409353 1/7 (14%)
Ig 14273..14356 CDD:416386 24/90 (27%)
Ig strand A' 14276..14282 CDD:409353 2/5 (40%)
Ig strand B 14289..14296 CDD:409353 2/8 (25%)
Ig strand C 14301..14306 CDD:409353 2/4 (50%)
Ig strand C' 14308..14311 CDD:409353 1/2 (50%)
Ig strand D 14316..14320 CDD:409353 0/3 (0%)
Ig strand E 14325..14332 CDD:409353 4/6 (67%)
Ig strand F 14339..14347 CDD:409353 3/7 (43%)
Ig 14362..14433 CDD:416386 19/130 (15%)
Ig strand A' 14365..14371 CDD:409353 1/5 (20%)
Ig strand B 14378..14385 CDD:409353 3/14 (21%)
Ig strand C 14390..14395 CDD:409353 2/4 (50%)
Ig strand C' 14397..14400 CDD:409353 0/2 (0%)
Ig strand D 14405..14409 CDD:409353 1/3 (33%)
Ig strand E 14414..14421 CDD:409353 0/6 (0%)
IG_like 14458..14522 CDD:214653 23/65 (35%)
Ig strand B 14466..14472 CDD:409353 2/5 (40%)
Ig strand C 14479..14484 CDD:409353 2/4 (50%)
Ig strand C' 14487..14490 CDD:409353 0/2 (0%)
Ig strand D 14495..14500 CDD:409353 0/5 (0%)
Ig strand E 14503..14508 CDD:409353 2/4 (50%)
Ig strand F 14517..14523 CDD:409353 3/5 (60%)
Ig strand G 14526..14534 CDD:409353 3/79 (4%)
Ig 14540..14623 CDD:416386 21/87 (24%)
Ig strand A 14542..14545 CDD:409353 0/2 (0%)
Ig strand A' 14547..14551 CDD:409353 1/3 (33%)
Ig strand B 14554..14563 CDD:409353 2/8 (25%)
Ig strand C 14568..14573 CDD:409353 1/5 (20%)
Ig strand C' 14576..14579 CDD:409353 0/2 (0%)
Ig strand D 14583..14588 CDD:409353 0/4 (0%)
Ig strand E 14589..14599 CDD:409353 1/9 (11%)
Ig strand G 14613..14623 CDD:409353 4/9 (44%)
Ig 14629..14717 CDD:416386 12/93 (13%)
Ig strand A' 14631..14637 CDD:409353 1/5 (20%)
Ig strand B 14644..14651 CDD:409353 0/6 (0%)
Ig strand C 14656..14661 CDD:409353 0/4 (0%)
Ig strand C' 14663..14666 CDD:409353 0/2 (0%)
Ig strand D 14671..14675 CDD:409353 0/3 (0%)
Ig strand E 14680..14687 CDD:409353 1/6 (17%)
Ig strand F 14694..14702 CDD:409353 0/7 (0%)
Ig strand G 14705..14717 CDD:409353 2/17 (12%)
Ig 14722..14805 CDD:416386 13/84 (15%)
Ig strand A' 14727..14732 CDD:409353 2/5 (40%)
Ig strand B 14737..14744 CDD:409353 1/6 (17%)
Ig strand C 14750..14756 CDD:409353 1/5 (20%)
Ig strand C' 14757..14760 CDD:409353 2/2 (100%)
Ig strand D 14766..14772 CDD:409353 0/5 (0%)
Ig strand E 14774..14784 CDD:409353 0/9 (0%)
Ig strand G 14795..14805 CDD:409353 0/9 (0%)
Ig 14811..14894 CDD:416386 17/91 (19%)
Ig strand A' 14814..14820 CDD:409353 2/11 (18%)
Ig strand B 14827..14834 CDD:409353 3/6 (50%)
Ig strand C 14839..14844 CDD:409353 0/4 (0%)
Ig strand C' 14846..14849 CDD:409353 0/2 (0%)
Ig strand D 14854..14858 CDD:409353 0/3 (0%)
Ig strand E 14863..14870 CDD:409353 3/6 (50%)
Ig strand F 14877..14885 CDD:409353 3/10 (30%)
Ig 14900..14982 CDD:416386 19/109 (17%)
Ig 14996..15073 CDD:416386 19/79 (24%)
Ig strand A 14996..14999 CDD:409353 0/2 (0%)
Ig strand B 15004..15010 CDD:409353 1/5 (20%)
Ig strand C 15016..15022 CDD:409353 1/5 (20%)
Ig strand D 15031..15036 CDD:409353 2/4 (50%)
Ig strand E 15037..15043 CDD:409353 1/5 (20%)
Ig strand F 15052..15060 CDD:409353 2/7 (29%)
Ig strand G 15063..15073 CDD:409353 1/9 (11%)
FN3 15077..15165 CDD:238020 30/92 (33%)
FN3 15178..15270 CDD:238020 14/92 (15%)
FN3 15279..15366 CDD:238020 14/99 (14%)
Ig 15397..15471 CDD:416386 10/77 (13%)
Ig strand B 15399..15405 CDD:409353 0/5 (0%)
Ig strand C 15411..15417 CDD:409353 0/5 (0%)
Ig strand D 15429..15434 CDD:409353 1/4 (25%)
Ig strand E 15435..15441 CDD:409353 0/5 (0%)
Ig strand F 15450..15458 CDD:409353 2/8 (25%)
Ig strand G 15461..15471 CDD:409353 1/9 (11%)
FN3 15475..15564 CDD:238020 18/105 (17%)
FN3 15575..15664 CDD:238020 14/93 (15%)
Ig 15687..15767 CDD:416386 16/101 (16%)
Ig strand A 15687..15690 CDD:409353 0/2 (0%)
Ig strand B 15695..15701 CDD:409353 0/11 (0%)
Ig strand C 15707..15713 CDD:409353 1/5 (20%)
Ig strand F 31103..31111 CDD:409353
Ig strand G 31114..31124 CDD:409353
FN3 31128..31219 CDD:238020
FN3 31227..31320 CDD:238020
FN3 31329..31419 CDD:238020
Ig_Titin_like 31442..31521 CDD:409406
Ig strand B 31451..31455 CDD:409406
Ig strand C 31464..31468 CDD:409406
Ig strand E 31487..31491 CDD:409406
Ig strand F 31501..31506 CDD:409406
Ig strand G 31514..31517 CDD:409406
FN3 31525..31616 CDD:238020
FN3 31622..31715 CDD:238020
Ig_Titin_like 31734..31815 CDD:409406
Ig strand B 31743..31747 CDD:409406
Ig strand C 31756..31760 CDD:409406
Ig strand E 31781..31785 CDD:409406
Ig strand F 31795..31800 CDD:409406
Ig strand G 31808..31811 CDD:409406
FN3 31819..31910 CDD:238020
FN3 31919..32012 CDD:238020
FN3 32020..32107 CDD:238020
Ig_Titin_like 32133..32211 CDD:409406
Ig strand B 32141..32145 CDD:409406
Ig strand C 32154..32158 CDD:409406
Ig strand E 32177..32181 CDD:409406
Ig strand F 32191..32196 CDD:409406
Ig strand D 15725..15730 CDD:409353 0/4 (0%)
Ig strand E 15731..15737 CDD:409353 1/5 (20%)
Ig strand F 15746..15754 CDD:409353 2/7 (29%)
Ig strand G 15757..15767 CDD:409353 2/21 (10%)
FN3 15771..15862 CDD:238020 19/98 (19%)
FN3 15870..15962 CDD:238020 24/88 (27%)
FN3 15971..16059 CDD:238020
FN3 16071..16157 CDD:238020
FN3 16171..16262 CDD:238020
FN3 16272..16363 CDD:238020
Ig 16383..16463 CDD:416386
Ig strand A 16383..16386 CDD:409353
Ig strand B 16391..16397 CDD:409353
Ig strand C 16403..16409 CDD:409353
Ig strand D 16421..16426 CDD:409353
Ig strand E 16427..16433 CDD:409353
Ig strand F 16442..16450 CDD:409353
Ig strand G 16453..16463 CDD:409353
FN3 16467..16553 CDD:238020
FN3 16572..16659 CDD:238020
Ig 16678..16785 CDD:416386
Ig strand B 16684..16690 CDD:409353
Ig strand C 16696..16702 CDD:409353
Ig strand D 16742..16747 CDD:409353
Ig strand E 16748..16755 CDD:409353
Ig strand F 16764..16772 CDD:409353
Ig strand G 16775..16785 CDD:409353
FN3 16789..16880 CDD:238020
FN3 16890..16982 CDD:238020
FN3 16996..17082 CDD:238020
Ig 17105..17180 CDD:416386
Ig strand B 17109..17115 CDD:409353
Ig strand C 17121..17127 CDD:409353
Ig strand D 17138..17143 CDD:409353
Ig strand E 17144..17150 CDD:409353
Ig strand F 17159..17167 CDD:409353
Ig strand G 17170..17180 CDD:409353
FN3 17184..17273 CDD:238020
FN3 17282..17374 CDD:238020
Ig 17394..17481 CDD:416386
Ig strand A 17394..17398 CDD:409353
Ig strand B 17403..17409 CDD:409353
Ig strand C 17415..17421 CDD:409353
Ig strand D 17434..17439 CDD:409353
Ig strand E 17440..17451 CDD:409353
Ig strand F 17460..17468 CDD:409353
Ig strand G 17471..17481 CDD:409353
FN3 17485..17569 CDD:214495
FN3 17586..17680 CDD:238020
FN3 17692..17783 CDD:238020
Ig_Titin_like 17806..17895 CDD:409406
Ig strand B 17815..17819 CDD:409406
Ig strand C 17828..17832 CDD:409406
Ig strand E 17861..17865 CDD:409406
Ig strand F 17875..17880 CDD:409406
Ig strand G 17888..17891 CDD:409406
FN3 17899..17991 CDD:238020
FN3 18004..18093 CDD:238020
Ig 18115..18200 CDD:416386
Ig strand B 18121..18127 CDD:409353
Ig strand C 18133..18144 CDD:409353
Ig strand D 18158..18163 CDD:409353
Ig strand E 18164..18170 CDD:409353
Ig strand F 18179..18187 CDD:409353
Ig strand G 18190..18200 CDD:409353
FN3 18204..18296 CDD:238020
FN3 18304..18401 CDD:238020
FN3 18415..18500 CDD:238020
Ig_Titin_like 18520..18599 CDD:409406
Ig strand B 18529..18533 CDD:409406
Ig strand C 18542..18546 CDD:409406
Ig strand E 18565..18569 CDD:409406
Ig strand F 18579..18584 CDD:409406
Ig strand G 18592..18595 CDD:409406
FN3 18603..18691 CDD:238020
FN3 18704..18797 CDD:238020
Ig 18815..18895 CDD:416386
Ig strand A 18815..18818 CDD:409353
Ig strand B 18823..18829 CDD:409353
Ig strand C 18835..18841 CDD:409353
Ig strand D 18853..18858 CDD:409353
Ig strand E 18859..18865 CDD:409353
Ig strand F 18874..18882 CDD:409353
Ig strand G 18885..18895 CDD:409353
FN3 18899..18991 CDD:238020
FN3 18999..19088 CDD:238020
FN3 19100..19188 CDD:238020
Ig 19216..19293 CDD:416386
Ig strand B 19223..19229 CDD:409353
Ig strand C 19235..19241 CDD:409353
Ig strand D 19251..19256 CDD:409353
Ig strand E 19257..19263 CDD:409353
Ig strand F 19272..19280 CDD:409353
Ig strand G 19283..19293 CDD:409353
FN3 19297..19384 CDD:238020
FN3 19397..19486 CDD:238020
Ig 19507..19587 CDD:416386
Ig strand A 19507..19510 CDD:409353
Ig strand B 19515..19521 CDD:409353
Ig strand C 19527..19533 CDD:409353
Ig strand D 19545..19550 CDD:409353
Ig strand E 19551..19557 CDD:409353
Ig strand F 19566..19574 CDD:409353
Ig strand G 19577..19587 CDD:409353
FN3 19591..19683 CDD:238020
FN3 19691..19782 CDD:238020
FN3 19791..19877 CDD:238020
Ig 19904..19985 CDD:416386
Ig strand A 19904..19908 CDD:409353
Ig strand B 19913..19919 CDD:409353
Ig strand C 19925..19931 CDD:409353
Ig strand D 19943..19948 CDD:409353
Ig strand E 19949..19955 CDD:409353
Ig strand F 19964..19972 CDD:409353
Ig strand G 19975..19985 CDD:409353
FN3 19989..20079 CDD:238020
FN3 20088..20181 CDD:238020
Ig 20188..20281 CDD:416386
Ig strand A 20188..20190 CDD:409353
Ig strand A' 20193..20198 CDD:409353
Ig strand B 20206..20214 CDD:409353
Ig strand C 20219..20223 CDD:409353
Ig strand C' 20227..20229 CDD:409353
Ig strand D 20236..20242 CDD:409353
Ig strand E 20245..20250 CDD:409353
Ig strand F 20259..20267 CDD:409353
Ig strand G 20270..20281 CDD:409353
FN3 20284..20375 CDD:238020
FN3 20383..20476 CDD:238020
FN3 20484..20582 CDD:238020
Ig_Titin_like 20603..20682 CDD:409406
Ig strand B 20611..20615 CDD:409406
Ig strand C 20624..20628 CDD:409406
Ig strand E 20648..20652 CDD:409406
Ig strand F 20662..20667 CDD:409406
Ig strand G 20675..20678 CDD:409406
FN3 20686..20772 CDD:238020
FN3 20786..20869 CDD:238020
Ig 20895..20975 CDD:416386
Ig strand A 20895..20898 CDD:409353
Ig strand B 20903..20909 CDD:409353
Ig strand C 20915..20921 CDD:409353
Ig strand D 20933..20938 CDD:409353
Ig strand E 20939..20945 CDD:409353
Ig strand F 20954..20962 CDD:409353
Ig strand G 20965..20975 CDD:409353
FN3 20979..21067 CDD:238020
FN3 21079..21172 CDD:238020
FN3 21178..21272 CDD:238020
Ig 21292..21372 CDD:416386
Ig strand A 21292..21295 CDD:409353
Ig strand B 21300..21306 CDD:409353
Ig strand C 21312..21318 CDD:409353
Ig strand D 21330..21335 CDD:409353
Ig strand E 21336..21342 CDD:409353
Ig strand F 21351..21359 CDD:409353
Ig strand G 21362..21372 CDD:409353
FN3 21376..21467 CDD:238020
FN3 21475..21567 CDD:238020
FN3 21576..21664 CDD:238020
Ig_Titin_like 21689..21770 CDD:409406
Ig strand B 21698..21702 CDD:409406
Ig strand C 21711..21715 CDD:409406
Ig strand E 21736..21740 CDD:409406
Ig strand F 21750..21755 CDD:409406
Ig strand G 21763..21766 CDD:409406
FN3 21774..21865 CDD:238020
FN3 21871..21955 CDD:238020
Ig_Titin_like 21978..22059 CDD:409406
Ig strand B 21987..21991 CDD:409406
Ig strand C 22000..22004 CDD:409406
Ig strand E 22025..22029 CDD:409406
Ig strand F 22039..22044 CDD:409406
Ig strand G 22052..22055 CDD:409406
FN3 22063..22155 CDD:238020
FN3 22163..22256 CDD:238020
FN3 22262..22351 CDD:238020
Ig 22375..22456 CDD:416386
Ig strand A 22375..22378 CDD:409353
Ig strand B 22383..22390 CDD:409353
Ig strand C 22396..22402 CDD:409353
Ig strand D 22414..22419 CDD:409353
Ig strand E 22420..22426 CDD:409353
Ig strand F 22435..22443 CDD:409353
Ig strand G 22446..22456 CDD:409353
FN3 22460..22551 CDD:238020
FN3 22566..22649 CDD:238020
FN3 22660..22747 CDD:238020
Ig_Titin_like 22772..22851 CDD:409406
Ig strand B 22781..22785 CDD:409406
Ig strand C 22794..22798 CDD:409406
Ig strand E 22817..22821 CDD:409406
Ig strand F 22831..22836 CDD:409406
Ig strand G 22844..22847 CDD:409406
FN3 22855..22944 CDD:238020
FN3 22952..23043 CDD:238020
Ig_Titin_like 23062..23142 CDD:409406
Ig strand B 23070..23074 CDD:409406
Ig strand C 23083..23087 CDD:409406
Ig strand E 23108..23112 CDD:409406
Ig strand F 23122..23127 CDD:409406
Ig strand G 23135..23138 CDD:409406
FN3 23146..23238 CDD:238020
FN3 23246..23336 CDD:238020
FN3 23345..23438 CDD:238020
Ig 23457..23538 CDD:416386
Ig strand A 23457..23461 CDD:409353
Ig strand B 23466..23472 CDD:409353
Ig strand C 23478..23484 CDD:409353
Ig strand D 23496..23501 CDD:409353
Ig strand E 23502..23508 CDD:409353
Ig strand F 23517..23525 CDD:409353
Ig strand G 23528..23538 CDD:409353
FN3 23542..23633 CDD:238020
FN3 23642..23734 CDD:238020
FN3 23743..23830 CDD:238020
Ig_Titin_like 23856..23935 CDD:409406
Ig strand B 23865..23869 CDD:409406
Ig strand C 23878..23882 CDD:409406
Ig strand E 23901..23905 CDD:409406
Ig strand F 23915..23920 CDD:409406
Ig strand G 23928..23931 CDD:409406
FN3 23939..24028 CDD:238020
FN3 24036..24119 CDD:238020
Ig_Titin_like 24143..24224 CDD:409406
Ig strand B 24152..24156 CDD:409406
Ig strand C 24165..24169 CDD:409406
Ig strand E 24190..24194 CDD:409406
Ig strand F 24204..24209 CDD:409406
Ig strand G 24217..24220 CDD:409406
FN3 24228..24320 CDD:238020
FN3 24328..24420 CDD:238020
FN3 24427..24520 CDD:238020
Ig_Titin_like 24539..24620 CDD:409406
Ig strand B 24548..24552 CDD:409406
Ig strand C 24561..24565 CDD:409406
Ig strand E 24586..24590 CDD:409406
Ig strand F 24600..24605 CDD:409406
Ig strand G 24613..24616 CDD:409406
FN3 24624..24716 CDD:238020
FN3 24724..24813 CDD:238020
FN3 24825..24913 CDD:238020
Ig_Titin_like 24938..25017 CDD:409406
Ig strand B 24947..24951 CDD:409406
Ig strand C 24960..24964 CDD:409406
Ig strand E 24983..24987 CDD:409406
Ig strand F 24997..25002 CDD:409406
Ig strand G 25010..25013 CDD:409406
FN3 25021..25108 CDD:238020
FN3 25118..25201 CDD:238020
Ig 25226..25305 CDD:416386
Ig strand A 25226..25229 CDD:409353
Ig strand B 25234..25240 CDD:409353
Ig strand C 25246..25252 CDD:409353
Ig strand D 25264..25269 CDD:409353
Ig strand E 25270..25276 CDD:409353
Ig strand F 25285..25293 CDD:409353
Ig strand G 25296..25305 CDD:409353
FN3 25310..25402 CDD:238020
FN3 25410..25503 CDD:238020
FN3 25509..25602 CDD:238020
Ig 25621..25702 CDD:416386
Ig strand A 25621..25625 CDD:409353
Ig strand B 25630..25636 CDD:409353
Ig strand C 25642..25648 CDD:409353
Ig strand D 25660..25665 CDD:409353
Ig strand E 25666..25672 CDD:409353
Ig strand F 25681..25689 CDD:409353
Ig strand G 25692..25702 CDD:409353
FN3 25706..25797 CDD:238020
FN3 25806..25896 CDD:238020
FN3 25907..25995 CDD:238020
Ig_Titin_like 26021..26099 CDD:409406
Ig strand B 26029..26033 CDD:409406
Ig strand C 26042..26046 CDD:409406
Ig strand E 26065..26069 CDD:409406
Ig strand F 26079..26084 CDD:409406
Ig strand G 26092..26095 CDD:409406
FN3 26103..26194 CDD:238020
FN3 26200..26283 CDD:238020
Ig_Titin_like 26307..26388 CDD:409406
Ig strand B 26316..26320 CDD:409406
Ig strand C 26329..26333 CDD:409406
Ig strand E 26354..26358 CDD:409406
Ig strand F 26368..26373 CDD:409406
Ig strand G 26381..26384 CDD:409406
FN3 26392..26485 CDD:238020
FN3 26492..26585 CDD:238020
FN3 26591..26684 CDD:238020
Ig 26703..26785 CDD:416386
Ig strand A 26703..26707 CDD:409353
Ig strand B 26712..26718 CDD:409353
Ig strand C 26724..26730 CDD:409353
Ig strand D 26743..26748 CDD:409353
Ig strand E 26749..26755 CDD:409353
Ig strand F 26764..26772 CDD:409353
Ig strand G 26775..26785 CDD:409353
FN3 26789..26881 CDD:238020
FN3 26889..26981 CDD:238020
FN3 26990..27078 CDD:238020
Ig_Titin_like 27103..27182 CDD:409406
Ig strand B 27112..27116 CDD:409406
Ig strand C 27125..27129 CDD:409406
Ig strand E 27148..27152 CDD:409406
Ig strand F 27162..27167 CDD:409406
Ig strand G 27175..27178 CDD:409406
FN3 27186..27275 CDD:238020
FN3 27283..27366 CDD:238020
Ig_Titin_like 27390..27471 CDD:409406
Ig strand B 27399..27403 CDD:409406
Ig strand C 27412..27416 CDD:409406
Ig strand E 27437..27441 CDD:409406
Ig strand F 27451..27456 CDD:409406
Ig strand G 27464..27467 CDD:409406
FN3 27475..27566 CDD:238020
FN3 27574..27658 CDD:238020
FN3 27673..27766 CDD:238020
Ig_Titin_like 27785..27866 CDD:409406
Ig strand B 27794..27798 CDD:409406
Ig strand C 27807..27811 CDD:409406
Ig strand E 27832..27836 CDD:409406
Ig strand F 27846..27851 CDD:409406
Ig strand G 27859..27862 CDD:409406
FN3 27870..27962 CDD:238020
FN3 27970..28060 CDD:238020
FN3 28071..28163 CDD:238020
Ig_Titin_like 28182..28261 CDD:409406
Ig strand B 28191..28195 CDD:409406
Ig strand C 28204..28208 CDD:409406
Ig strand E 28227..28231 CDD:409406
Ig strand F 28241..28246 CDD:409406
Ig strand G 28254..28257 CDD:409406
FN3 28265..28356 CDD:238020
FN3 28362..28445 CDD:238020
Ig_Titin_like 28472..28553 CDD:409406
Ig strand B 28481..28485 CDD:409406
Ig strand C 28494..28498 CDD:409406
Ig strand E 28519..28523 CDD:409406
Ig strand F 28533..28538 CDD:409406
Ig strand G 28546..28549 CDD:409406
FN3 28557..28650 CDD:238020
FN3 28657..28747 CDD:238020
FN3 28756..28849 CDD:238020
Ig_Titin_like 28868..28949 CDD:409406
Ig strand B 28877..28881 CDD:409406
Ig strand C 28890..28894 CDD:409406
Ig strand E 28915..28919 CDD:409406
Ig strand F 28929..28934 CDD:409406
Ig strand G 28942..28945 CDD:409406
FN3 28953..29045 CDD:238020
FN3 29053..29145 CDD:238020
FN3 29154..29245 CDD:238020
Ig_Titin_like 29268..29349 CDD:409406
Ig strand B 29276..29280 CDD:409406
Ig strand C 29289..29293 CDD:409406
Ig strand E 29314..29318 CDD:409406
Ig strand F 29328..29333 CDD:409406
Ig strand G 29342..29345 CDD:409406
FN3 29353..29442 CDD:238020
FN3 29450..29541 CDD:238020
Ig 29560..29627 CDD:416386
Ig strand A 29560..29563 CDD:409353
Ig strand B 29568..29574 CDD:409353
Ig strand C 29580..29586 CDD:409353
Ig strand D 29598..29603 CDD:409353
Ig strand E 29604..29610 CDD:409353
Ig strand F 29619..29627 CDD:409353
FN3 29644..29736 CDD:238020
FN3 29744..29836 CDD:238020
FN3 29843..29931 CDD:238020
Ig 29955..30035 CDD:416386
Ig strand A 29955..29958 CDD:409353
Ig strand B 29963..29969 CDD:409353
Ig strand C 29975..29981 CDD:409353
Ig strand D 29991..29996 CDD:409353
Ig strand E 29997..30005 CDD:409353
Ig strand F 30014..30022 CDD:409353
Ig strand G 30025..30035 CDD:409353
FN3 30046..30131 CDD:238020
FN3 30139..30226 CDD:238020
FN3 30241..30330 CDD:238020
Ig_Titin_like 30353..30432 CDD:409406
Ig strand B 30362..30366 CDD:409406
Ig strand C 30375..30379 CDD:409406
Ig strand E 30398..30402 CDD:409406
Ig strand F 30412..30417 CDD:409406
Ig strand G 30425..30428 CDD:409406
FN3 30436..30520 CDD:238020
FN3 30533..30616 CDD:238020
Ig_Titin_like 30644..30724 CDD:409406
Ig strand B 30652..30656 CDD:409406
Ig strand C 30665..30669 CDD:409406
Ig strand E 30690..30694 CDD:409406
Ig strand F 30704..30709 CDD:409406
Ig strand G 30717..30720 CDD:409406
FN3 30728..30820 CDD:238020
FN3 30828..30920 CDD:238020
FN3 30927..31023 CDD:238020
Ig 31044..31124 CDD:416386
Ig strand A 31044..31047 CDD:409353
Ig strand B 31052..31058 CDD:409353
Ig strand C 31064..31070 CDD:409353
Ig strand D 31082..31087 CDD:409353
Ig strand E 31088..31094 CDD:409353
Ig strand G 32204..32207 CDD:409406
FN3 32215..32305 CDD:238020
FN3 32325..32410 CDD:238020
FN3 32418..32503 CDD:238020
I-set 32528..32607 CDD:400151
Ig strand B 32537..32541 CDD:409353
Ig strand C 32550..32554 CDD:409353
Ig strand E 32575..32579 CDD:409353
Ig strand F 32589..32594 CDD:409353
Ig 32629..32704 CDD:416386
Ig strand B 32633..32639 CDD:409353
Ig strand C 32645..32651 CDD:409353
Ig strand D 32663..32668 CDD:409353
Ig strand E 32669..32675 CDD:409353
Ig strand F 32685..32693 CDD:409353
Ig strand G 32696..32704 CDD:409353
FN3 32710..32803 CDD:238020
FN3 32812..32905 CDD:238020
Ig 32915..33007 CDD:416386
Ig strand A 32915..32917 CDD:409353
Ig strand A' 32919..32925 CDD:409353
Ig strand B 32932..32939 CDD:409353
Ig strand C 32945..32950 CDD:409353
Ig strand C' 32952..32955 CDD:409353
Ig strand D 32961..32965 CDD:409353
Ig strand E 32971..32978 CDD:409353
Ig strand F 32985..32993 CDD:409353
Ig strand G 32996..33007 CDD:409353
Ig_Titin_like 33024..33105 CDD:409406
Ig strand B 33032..33036 CDD:409406
Ig strand C 33045..33049 CDD:409406
Ig strand E 33070..33074 CDD:409406
Ig strand F 33085..33090 CDD:409406
Ig strand G 33098..33101 CDD:409406
FN3 33109..33200 CDD:238020
STKc_Titin 33237..33513 CDD:271006
IgI_Titin_M1-like 33556..33645 CDD:409521
Ig strand B 33572..33576 CDD:409521
Ig strand C 33586..33590 CDD:409521
Ig strand E 33611..33615 CDD:409521
Ig strand F 33625..33630 CDD:409521
Ig strand G 33638..33641 CDD:409521
I-set 33676..33768 CDD:400151
Ig strand A 33676..33678 CDD:409353
Ig strand A' 33680..33686 CDD:409353
Ig strand B 33693..33700 CDD:409353
Ig strand C 33706..33711 CDD:409353
Ig strand C' 33713..33716 CDD:409353
Ig strand D 33724..33728 CDD:409353
Ig strand E 33733..33740 CDD:409353
Ig strand F 33747..33755 CDD:409353
Ig strand G 33758..33768 CDD:409353
I-set 33781..33871 CDD:400151
Ig strand A' 33786..33790 CDD:409353
Ig strand B 33798..33806 CDD:409353
Ig strand C 33811..33816 CDD:409353
Ig strand C' 33819..33821 CDD:409353
Ig strand D 33827..33832 CDD:409353
Ig strand E 33836..33841 CDD:409353
Ig strand F 33850..33858 CDD:409353
Ig strand G 33861..33871 CDD:409353
Ig 34361..34450 CDD:416386
Ig strand A 34361..34363 CDD:409353
Ig strand A' 34365..34371 CDD:409353
Ig strand B 34378..34385 CDD:409353
Ig strand C 34391..34396 CDD:409353
Ig strand C' 34398..34401 CDD:409353
Ig strand D 34406..34410 CDD:409353
Ig strand E 34415..34422 CDD:409353
Ig strand F 34429..34437 CDD:409353
Ig strand G 34440..34450 CDD:409353
PTZ00121 <34455..35189 CDD:173412
IgI_Titin_like 34545..34636 CDD:143224
Ig strand B 34565..34569 CDD:143224
Ig strand C 34578..34582 CDD:143224
Ig strand E 34603..34607 CDD:143224
Ig strand F 34617..34622 CDD:143224
Ig strand G 34630..34633 CDD:143224
Ig 34705..34794 CDD:416386
Ig strand B 34720..34724 CDD:409353
Ig strand C 34735..34739 CDD:409353
Ig strand E 34761..34765 CDD:409353
Ig strand F 34775..34780 CDD:409353
Ig strand A 34884..34891 CDD:409353
I-set 34891..34980 CDD:400151
Ig strand A' 34898..34903 CDD:409353
Ig strand B 34908..34916 CDD:409353
Ig strand C 34920..34926 CDD:409353
Ig strand C' 34928..34930 CDD:409353
Ig strand D 34936..34942 CDD:409353
Ig strand E 34945..34951 CDD:409353
Ig strand F 34960..34967 CDD:409353
Ig strand G 34970..34979 CDD:409353
I-set 35173..35262 CDD:400151
Ig strand A 35173..35175 CDD:409353
Ig strand A' 35177..35183 CDD:409353
Ig strand B 35190..35197 CDD:409353
Ig strand C 35203..35208 CDD:409353
Ig strand C' 35210..35213 CDD:409353
Ig strand E 35227..35234 CDD:409353
Ig strand F 35241..35249 CDD:409353
Ig strand G 35252..35262 CDD:409353
I-set 35368..35460 CDD:400151
Ig strand A 35377..35380 CDD:409353
Ig strand B 35385..35391 CDD:409353
Ig strand C 35397..35403 CDD:409353
Ig strand D 35418..35423 CDD:409353
Ig strand E 35424..35430 CDD:409353
Ig strand F 35439..35447 CDD:409353
Ig strand G 35450..35458 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9444
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.