DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Strn-Mlck and obsl1

DIOPT Version :10

Sequence 1:NP_001261019.1 Gene:Strn-Mlck / 36753 FlyBaseID:FBgn0265045 Length:8255 Species:Drosophila melanogaster
Sequence 2:XP_031749624.1 Gene:obsl1 / 100489080 XenbaseID:XB-GENE-5945765 Length:2466 Species:Xenopus tropicalis


Alignment Length:2817 Identity:611/2817 - (21%)
Similarity:958/2817 - (34%) Gaps:869/2817 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  5314 GSDLKLTCGLSGH-EMNVQWFK---------DNCPIEN-GAKYRRTLNDGLSCLEIKSAELGDSG 5367
            ||...|.|.:||. ...|:|.:         |.|.::| |..|:..::|         ....|:|
 Frog    36 GSQAVLRCRISGDPPPQVRWERAGNIRMELGDRCAVQNDGDWYQLVISD---------LRPEDTG 91

  Fly  5368 IYRCIASNQNGEVETSCLVT-------IYEAPSS----------KFGTPPIFT------------ 5403
            .|.|.|||.:||......:|       |.|.|::          ...||.:.|            
 Frog    92 HYMCRASNWSGEGYAGAKITVTPNLNPIAEPPANLPLQPHLPVISHDTPSLPTVSSDSCTKAQSL 156

  Fly  5404 -----------------RNIRDAYHSQ----------------------GNQLTLECKVSGSPKP 5429
                             .||.|...::                      |....|.|||||.|:|
 Frog   157 THKRISETSTSQEADLNANILDLSQTELPPVTELPPHFLLTPVSQRLCRGQSGELTCKVSGVPEP 221

  Fly  5430 HIYWQRDNTLLP--IEGTKYQYEEQSDGIKLLTINNFGSNDSGLYTCYAESENGQMKISKFVQAS 5492
            .|.|::|...|.  .:|:.|..   |.|...|:|:.....|:|:|.|.|.:..||. ::..|...
 Frog   222 TIRWEKDGRSLDELCDGSHYCL---SPGGHTLSISRVHPPDAGVYVCRATNTAGQC-LAAAVVLV 282

  Fly  5493 DYVRERIADKKPIDKVIQEIKRDESSSAAANDTAAAKAKAREAKLRLNLETSLKTMTIGSGNKAQ 5557
            |..:....:..|.|...|                                  :|..|:..|..|:
 Frog   283 DPTQRHGQEPYPGDPPAQ----------------------------------VKVFTVNEGKHAK 313

  Fly  5558 LICYVTGIIE-DVHWLRNDERVTKDARHKIY-NINGAISLEIYDARVEDSGHYRCVVKNSRQTVE 5620
            |.|.|||... ::.|.::...|:...|..|| :..|...|::...|.:|.|.|.|...|:.....
 Frog   314 LRCLVTGKPRPEIIWRKDGRAVSPGRRTLIYEDREGHFILKVLFCRQQDRGLYVCGASNTAGNTL 378

  Fly  5621 SAGQLSVLDQSTGKLPESFSSGIIESYDDQRNEIVLSCQVIGRPSVSWMRDDHSICNNRYRTIEE 5685
            ||..|.|.:     :.|.|.:.:.:....:..:.||.|.|......||..:|..:..::...:||
 Frog   379 SAVMLHVRE-----IGERFPAPLKDIAVREGQDAVLECSVPDGSRTSWYLEDQRLHPDKRHHMEE 438

  Fly  5686 PGGVRKLVIRNPISSDCGIFACYAEHEDRIDSTSITIKAA------DLKRLINV----------- 5733
            .|.:|:|:||...:.|.|::.|..:.    .|.||...|.      .|.|.:.|           
 Frog   439 QGPIRRLIIRGARTDDDGVYMCQTQQ----GSQSIAEVAVRGPITKKLPRRLEVAEGGNAAFCAE 499

  Fly  5734 SQEEIPSIGDHESTPWSRSQSHLSSGSQ---VNGNGELHRAGDRVLRNVG-----KGKPLFHTLL 5790
            ::.|:..||      |:.: .|:.|.:|   |...|..|     ||..||     .|...||..|
 Frog   500 TESEMEQIG------WTLN-GHILSETQRMVVQSFGRTH-----VLVLVGVTQKDAGIVQFHAGL 552

  Fly  5791 HD-----------------------RTVSEGANLRLVCSVSGDENTHIEWLKNHKPLPRSDNRYQ 5832
            .:                       ||:..|..|.|.|.|.|.. ..:.|:|:.:.|  ....:.
 Frog   553 SESSCQLRVKARGVSIKPATGEAANRTLGAGQPLCLSCHVPGSA-VRVRWMKDGQEL--ESGGHF 614

  Fly  5833 TVYLNGEA-SLEIFAAVADDSGNYTCCATNDFGESLTHAQLRVYKNFKEAPLPSTFTQPIRDTYS 5896
            |:...|.. .|.|.::...|||.|| |.|.|...|.|       .:..|.|:....|........
 Frog   615 TIQSEGRVRRLLISSSHPSDSGTYT-CHTADGSVSFT-------VSVNEPPVKIINTSDNTQHKC 671

  Fly  5897 LNENELVLDCRVRGQPRPEIQWIKGTEPIEASEKFKPSDQADG-YAKLVIVNPTEKDSGIYWCVA 5960
            |...::||.|.| .:....::|.:....:...|..:.  :||| :.:|||.:...:|||.:.|.|
 Frog   672 LAGEQVVLSCEV-SRESAHVRWYRDGAELGEHEGLRL--EADGRHRRLVIPSAKPQDSGEFVCDA 733

  Fly  5961 RNEGAENKISHQVDFKGRQHYSLEKTHGFFHRDPNKPHFLLPLGNQTVC--------NGGTVAIS 6017
            .|:..                       |:|....:|    |:.....|        :||.|.:|
 Frog   734 GNDSV-----------------------FYHVTVKEP----PVKIVNTCDDTEHSCLSGGQVELS 771

  Fly  6018 AEFMETSTPIEVKWLRDR-RVVDGPNVKALADRGVYTLTIMNAGPEVEGTYTCRASNAFGRIESN 6081
            .|....|.  .|:|.:|. .|.:...::..:|.....|.|..||.:..|.:.|...      :.:
 Frog   772 CEVSRESA--RVRWYKDGVEVEETEGIRLESDGRHRRLVICAAGTQDSGEFVCDTG------DDS 828

  Fly  6082 VNVDVAVGAEKDERPPLFL--SRPDTEMKIAVGDPFSLSFRIAGDPKPKLTFMKGTKDITQSDRV 6144
            |..:|.|     ..||:.:  :..|||.....|....||..::.: ..::.:.|...::.:::.|
 Frog   829 VFYNVTV-----TEPPVTIVNTSDDTEHSCLSGGQVELSCEVSRE-SARVRWYKDGTEVEETEGV 887

  Fly  6145 SKEVSDDYTRFSVQQAQISDSGTYFVVARNNFGTDRIFVTVTVNPRARSATPTQPRWGLPLDSYS 6209
            ..|....:.|..:..|...|.|.:...|    |||.||.||||                      
 Frog   888 RLESDGKHRRLVISNAHTRDCGEFVCDA----GTDSIFYTVTV---------------------- 926

  Fly  6210 DTSYFRDPPGCI-----STEPLVVDSGPTHISLSWGKPVSANSAPVMAYKVEAWVVGHEG----- 6264
                 |:||..|     .||...:..|...:|..    ||..||.|..||....|...||     
 Frog   927 -----REPPVTIVNTSDDTEHSCLSGGQVELSCE----VSRESARVRWYKDGVEVEETEGIRLES 982

  Fly  6265 ----------GAYWRELGLTPINSFDAFNLKPNVEYHF----------RVTPKNRYGW--GPTVQ 6307
                      .|:.|:.|....::.|     .:|.|..          |:..:....|  |..|:
 Frog   983 DGKHRRLVISNAHTRDCGEFVCDAGD-----DSVFYTLTVREPPVTITRIMEEAEQRWLSGEAVE 1042

  Fly  6308 TSSPL-QVGG--------VECLP--------------------------EF-------------- 6323
            .|..: |.||        ||.:.                          |:              
 Frog  1043 LSCEVSQDGGRVRWFRDNVELVESEKIQVQSDGKLRRLLITSAAPQDSGEYVCDSGDDSVAFNVL 1107

  Fly  6324 -----VKIL---PGQAKALLGSSFTLQCNMRGAPRPQVTWFKDGIQLSSSSERVKIRQIGSTCAL 6380
                 |:||   ||:.:.|.|.|.||.|.: ......|.|:|||.:| ..||||::...|:...|
 Frog  1108 VAEPPVRILSDDPGEVRRLSGESVTLSCEL-SRESALVRWYKDGERL-EESERVRMESEGALRRL 1170

  Fly  6381 TIATVSELDSGRYTCEATNSKGRVSTFARLQVVSDSRIYEADSRLKEIAHGRNVADVGDSLPIFT 6445
            .|.:....|||.:.|:|    |..|.|..:.|.      |..::|:         :.|.|     
 Frog  1171 LILSARVGDSGEFVCDA----GDDSAFYSVTVT------EPPAKLE---------NTGGS----- 1211

  Fly  6446 MRLRDRRVQVTYPVRLTCQIVGYPVPEILWYKDDELIHTDRKHLISAEGQFFTLEIAATTLDDSG 6510
               .::|......|.|:|::.....| :.||||.||:......::.|||:...|.|.|....|||
 Frog  1212 ---AEQRCLSGGRVVLSCEVSREDAP-VSWYKDGELLGEGENVILEAEGRHRRLIIPAARAQDSG 1272

  Fly  6511 TYTCLARNELGSVSCHCTLVVDKGIRAYISPDFYVPLDPFYIF-----------REGSEIRLSTK 6564
            .:.|    :.|..|...::.|               .||..|.           ..|.::.||.:
 Frog  1273 EFVC----DSGDDSLFYSITV---------------TDPPVIIVNTSEDSDLKCLTGEQVLLSCE 1318

  Fly  6565 VEAYPSVGVTWHRNGMRLRPSRRLTATLDSNGYV-ELIIAEATVRDAGIYVCVASNVVGKVETIC 6628
            | :..|..|.|:|:|:.:..|.|:  .|:.:|.: .|.|..|...|:|.|||             
 Frog  1319 V-SRESAHVAWYRDGVEVEESDRV--RLEEDGTIRRLTILCAETHDSGEYVC------------- 1367

  Fly  6629 RVAVEEAENKAVAPQRSLEIPSIK----TDDLPYSKEPLFVVKPRSSEAYEGDNVIIFCEVVGDP 6689
                 :|.:.:|....|:..|.:|    :|||             ..:...|:.|::.|||..: 
 Frog  1368 -----DARDDSVFYYLSVTEPPVKFVNTSDDL-------------ELKCVTGEQVVLSCEVTRE- 1413

  Fly  6690 KPEVVWLRDFLNPEYYKDAPHFRRIGDGPEYRLEIPSAKLDFTGTYSVIASNCHGEAKAVISLQI 6754
            ...|.|.||.:..|   :|...|...||...||.||:|:...:|.:.     |.....||....|
 Frog  1414 NARVRWYRDGMEVE---EAEGIRVESDGRYRRLVIPNAQPQDSGEFV-----CDSGDDAVFYSVI 1470

  Fly  6755 FAKDILNKSRMDKVHTRHGNIETLPRFVRNLRNLRCCDGDAISLECHVEADPEPFIIWEKDGHVM 6819
            .        |.......|..|.|        ::|:...|:.:.|...|... :..:.|.|||..:
 Frog  1471 I--------REPPTKILHPKIRT--------QDLQFITGERVQLVVDVSRS-DGRVRWFKDGLEV 1518

  Fly  6820 PSDRDYVMSFDGTKATLSIPRVYPEDEGEYTCVAKNSVGRSLSSACIIVDVPEEKENMLSRQLAR 6884
            ..|.:..:..:|.:..|.:|....||.|||.|...:      .||...|.|.|....:|      
 Frog  1519 DEDDNLQVMSEGLRRRLVLPCAVVEDSGEYICDTDS------DSATFDVKVLEPPVKIL------ 1571

  Fly  6885 PSGLLSAHSTPRSTPRSTPARSFSPLRLSYRTSSIDLSGVAERRRSDARNAITAPKFLAIPYNRV 6949
            |||.                 |.|.|.                                      
 Frog  1572 PSGC-----------------SASVLN-------------------------------------- 1581

  Fly  6950 VEEGDSVRFQCAISGHPTPWATWDKDGLIVTPTPRIAVKEIDDLRIIEIDEVTFDDAGLYRVTLE 7014
            |.|||.:...|.:| ..:....|.|||..:|||..||::.......:....|..:|||.|...:.
 Frog  1582 VMEGDPLSLHCELS-RGSADLRWLKDGEELTPTQNIALEAAGTRHTLRFLSVQPEDAGQYHCNVG 1645

  Fly  7015 NDFGRIEATARLDVIRSSRYSKSPSVRSVRASSSRRNAHLYRRIMGPSTAIGGRMALASGYRGSS 7079
            .|       :|:..:         :|...|.....|...:.||....|..:  |:||:.....: 
 Frog  1646 GD-------SRVFTV---------NVDENRVRILEREQMVPRRFCTVSEDL--RLALSLSRADA- 1691

  Fly  7080 VPSVRFYHNDVELEASERVHILLQDSMA--LLIVDNVTREDEGQYTCIISGDH--------DPLI 7134
              .||:|.:...|.  :..|||:::..|  .|.:..:.|.|.|:|.|.:|.|.        ||.:
 Frog  1692 --EVRWYKDGERLR--DAPHILVEERGAECSLTILGLERADAGEYLCDVSRDSFSFYVAVGDPPV 1752

  Fly  7135 TSTTVTFHDSNTEIRRRRAVITERLPEITKSLEGEVIDLCCSIECDEP-YSYVWLRNGEILPDSD 7198
            |..      .||....:..::|           |:  ||..:.|...| :...||||||.|..:.
 Frog  1753 TIV------GNTGTPEQHLLMT-----------GD--DLVLTCELSRPNFKVRWLRNGEELVSAG 1798

  Fly  7199 EFNYIDHGNGRLCLRINDAFDIDSGIYSC-----QVFTS-------------------------- 7232
            ....:..|..|. |.|.:....|||.|:|     |:.||                          
 Frog  1799 RVKILARGVHRQ-LTIQNVRPGDSGTYTCDAGTDQMHTSVYVEAPRVVEFVTELQNITVLEGETA 1862

  Fly  7233 ---------------DINDST--SDSTFDS------HSI----CSLINSGCSDCSSSG-----EL 7265
                           ::|.|.  ||..|.:      ||:    |.|.:||....::.|     :|
 Frog  1863 SFKCMVSPDDVDLRWELNGSPVYSDKRFSTTSTGMCHSLTLRSCRLSDSGKVTANAEGLLSRAKL 1927

  Fly  7266 CVLE---------RDLRGQDEECVQLLKTPLPVVCASGDEALFYARVFPCDAEADWYLNGQLLAQ 7321
            .|.|         :|:..::|:.::|                 ..:|....||..|...|.::  
 Frog  1928 RVQEAQVLFTQGLQDMEAEEEQDLEL-----------------RVQVTKDQAEIHWVKQGVVI-- 1973

  Fly  7322 ADDSLNMTLESYPENGIRLLRMRDVTASRSGEICLQVKHPQAEFRRIPTTRTYTSLLVLPAIRGN 7386
             ..|...||::  ......|.:..:.||..|..|.:..|.:.|.|...|.|:.:....|..|:  
 Frog  1974 -QPSPKYTLQA--SGCTHSLTIHRLQASDRGRYCCESLHDRTECRLNVTPRSISIRKGLKDIK-- 2033

  Fly  7387 SSSSSLAARSCILTRPEDCTALIGGHVRLSVRYEPFPGTKVIWYKACHPIVESSNVTIRTTSQQS 7451
                              |....|....:.:.:|...|.   |:|....:...:..|||.:.:|.
 Frog  2034 ------------------CEEGSGVDFTVELSHEGLVGE---WWKGGVRVTNDNQCTIRASGRQH 2077

  Fly  7452 TLYITDISADDS-------------GKYTVE-------------VMNDYGV---------EAAAA 7481
            .|:::|::..||             .:.||.             |:|:.|.         :.|..
 Frog  2078 FLHLSDLTVPDSCVIAFIADSLRTTAQLTVTEPPLTITQPPQDFVVNEGGAATFQCEVSRQEATV 2142

  Fly  7482 SVAVEGPPEPPSGQPSV-SLGPDRV-AVAWCGPPYDGG---CMITGFIIEMQTIGDENCDEDSWQ 7541
            :...:|....||.:..: |:|..|: .::.|||| |.|   |          .:||.|..     
 Frog  2143 TWDKDGVQLVPSARCRMYSVGRRRILQLSQCGPP-DAGTYTC----------HMGDINAG----- 2191

  Fly  7542 QVTRVVDSLAYTVKNLQPERQYRFRVRAEN------IHGRSAPGQ---ASELVQITNTPQRSTSS 7597
            ...||::.....:|:||...    .|..||      :....|.|:   ..|.:::|||       
 Frog  2192 ATLRVLEQEPQMLKDLQDVD----IVENENAVFTCEVSCAQAKGEWFKNGEPIRVTNT------- 2245

  Fly  7598 DASDRFGQATVSVQSGGDFKSRFEII-----EELGKGRFGIVYKVQERGQPEQLLAAKV-IKCIK 7656
                     |...|.|   :..|.:|     |:.|:    |.::.:......:|...:: ::.:|
 Frog  2246 ---------TKIRQEG---RRHFLLICGAQCEDAGE----ITFRARRLQSTARLRIKEIPVRIVK 2294

  Fly  7657 S-QDRQKVLEEISIMRALQHPKLLQLAASFESPREIVMVMEY-ITGGELFERVVADDFTLTEMDC 7719
            | :||..:.....::....:|...| |......|||....:| |...:.|.:::..|....:.|.
 Frog  2295 SLRDRTALEGHRVVLECKVNPPRAQ-AKWLRGGREIFPSAKYQICNEDGFHKLIIADVAPEDEDM 2358

  Fly  7720 ILFLRQVCDGVAYMHGQSVVHL 7741
            ..        |:...|||...|
 Frog  2359 YT--------VSTAGGQSSARL 2372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Strn-MlckNP_001261019.1 Ig_3 26..112 CDD:464046
Ig <70..112 CDD:472250
Ig strand E 92..96 CDD:409353
Ig strand F 106..111 CDD:409353
Ig 137..226 CDD:472250
Ig strand B 154..158 CDD:409353
Ig strand C 167..171 CDD:409353
Ig strand E 192..196 CDD:409353
Ig strand F 206..211 CDD:409353
Ig strand G 219..222 CDD:409353
Ig 235..314 CDD:472250
Ig strand B 251..255 CDD:409564
Ig strand C 264..268 CDD:409564
Ig strand E 280..284 CDD:409564
Ig strand F 294..299 CDD:409564
Ig strand G 307..310 CDD:409564
Ig_3 336..414 CDD:464046
Ig 438..513 CDD:472250
Ig strand B 454..458 CDD:409564
Ig strand C 467..471 CDD:409564
Ig strand E 483..487 CDD:409564
Ig strand F 493..498 CDD:409564
Ig strand G 506..509 CDD:409564
Ig 537..628 CDD:472250
Ig strand B 554..558 CDD:409353
Ig strand C 567..571 CDD:409353
Ig strand F 607..612 CDD:409353
Ig strand G 620..623 CDD:409353
Ig 636..713 CDD:472250
Ig strand B 652..656 CDD:409564
Ig strand C 665..669 CDD:409564
Ig strand E 681..685 CDD:409564
Ig strand F 695..700 CDD:409564
Ig strand G 708..711 CDD:409564
SMC_N <2131..2664 CDD:481474
PTZ00121 <2600..3256 CDD:173412
PTZ00121 <3635..4609 CDD:173412
PTZ00121 <4215..5072 CDD:173412
I-set 5300..5388 CDD:400151 24/91 (26%)
Ig strand B 5317..5321 CDD:409353 1/3 (33%)
Ig strand C 5329..5333 CDD:409353 1/3 (33%)
Ig strand E 5354..5358 CDD:409353 0/3 (0%)
Ig strand F 5368..5373 CDD:409353 2/4 (50%)
Ig_3 5399..5477 CDD:464046 28/130 (22%)
Ig 5542..5627 CDD:472250 25/86 (29%)
Ig strand B 5556..5560 CDD:409353 2/3 (67%)
Ig strand C 5568..5572 CDD:409353 0/3 (0%)
Ig strand E 5593..5597 CDD:409353 1/3 (33%)
Ig strand F 5607..5612 CDD:409353 2/4 (50%)
Ig 5654..5721 CDD:409353 19/66 (29%)
Ig strand B 5654..5658 CDD:409353 2/3 (67%)
Ig strand C 5665..5669 CDD:409353 1/3 (33%)
Ig strand E 5690..5694 CDD:409353 2/3 (67%)
Ig strand F 5704..5709 CDD:409353 1/4 (25%)
Ig strand G 5718..5721 CDD:409353 1/2 (50%)
I-set 5784..5874 CDD:400151 28/113 (25%)
Ig strand B 5801..5805 CDD:409353 2/3 (67%)
Ig strand C 5814..5818 CDD:409353 0/3 (0%)
Ig strand E 5840..5844 CDD:409353 1/4 (25%)
Ig strand F 5854..5859 CDD:409353 2/4 (50%)
Ig 5902..5963 CDD:409353 17/61 (28%)
Ig strand B 5902..5906 CDD:409353 2/3 (67%)
Ig strand C 5915..5919 CDD:409353 0/3 (0%)
Ig strand E 5941..5945 CDD:409353 1/3 (33%)
Ig strand F 5955..5960 CDD:409353 1/4 (25%)
Ig 5997..6086 CDD:472250 21/97 (22%)
Ig strand B 6014..6018 CDD:409353 1/3 (33%)
Ig strand C 6028..6032 CDD:409353 1/3 (33%)
Ig strand E 6050..6056 CDD:409353 1/5 (20%)
Ig strand F 6066..6071 CDD:409353 1/4 (25%)
Ig strand G 6079..6082 CDD:409353 0/2 (0%)
Ig 6107..6187 CDD:472250 18/79 (23%)
Ig strand B 6115..6119 CDD:409353 1/3 (33%)
Ig strand C 6128..6132 CDD:409353 0/3 (0%)
Ig strand E 6153..6157 CDD:409353 1/3 (33%)
Ig strand F 6167..6172 CDD:409353 0/4 (0%)
Ig strand G 6180..6183 CDD:409353 1/2 (50%)
FN3 6216..6310 CDD:238020 27/125 (22%)
I-set 6321..6412 CDD:400151 33/138 (24%)
Ig strand B 6339..6343 CDD:409353 2/3 (67%)
Ig strand C 6352..6356 CDD:409353 1/3 (33%)
Ig strand E 6375..6382 CDD:409353 2/6 (33%)
Ig strand F 6392..6397 CDD:409353 1/4 (25%)
Ig strand G 6405..6408 CDD:409353 1/2 (50%)
I-set 6442..6531 CDD:400151 23/88 (26%)
Ig strand B 6459..6463 CDD:409353 2/3 (67%)
Ig strand C 6472..6476 CDD:409353 0/3 (0%)
Ig strand E 6497..6501 CDD:409353 1/3 (33%)
Ig strand F 6511..6516 CDD:409353 1/4 (25%)
Ig strand G 6524..6527 CDD:409353 1/2 (50%)
Ig 6541..6632 CDD:472250 24/102 (24%)
Ig strand B 6559..6563 CDD:409353 1/3 (33%)
Ig strand C 6572..6576 CDD:409353 1/3 (33%)
Ig strand E 6598..6602 CDD:409353 1/4 (25%)
Ig strand F 6612..6617 CDD:409353 3/4 (75%)
Ig strand G 6625..6628 CDD:409353 0/2 (0%)
Ig 6662..6754 CDD:472250 23/91 (25%)
Ig strand B 6679..6683 CDD:409353 1/3 (33%)
Ig strand C 6692..6696 CDD:409353 1/3 (33%)
Ig strand E 6720..6724 CDD:409353 2/3 (67%)
Ig strand F 6734..6739 CDD:409353 0/4 (0%)
I-set 6779..6868 CDD:400151 20/88 (23%)
Ig strand B 6796..6800 CDD:409353 1/3 (33%)
Ig strand C 6809..6813 CDD:409353 0/3 (0%)
Ig strand E 6834..6838 CDD:409353 1/3 (33%)
Ig strand F 6848..6853 CDD:409353 3/4 (75%)
I-set 6939..7028 CDD:400151 22/88 (25%)
Ig strand B 6956..6960 CDD:409353 0/3 (0%)
Ig strand C 6969..6973 CDD:409353 0/3 (0%)
Ig strand E 6993..6998 CDD:409353 0/4 (0%)
Ig strand F 7008..7013 CDD:409353 1/4 (25%)
Ig strand G 7021..7024 CDD:409353 0/2 (0%)
IG_like 7075..7140 CDD:214653 19/74 (26%)
Ig strand C 7082..7086 CDD:409353 2/3 (67%)
Ig strand E 7107..7111 CDD:409353 2/5 (40%)
Ig strand F 7121..7126 CDD:409353 2/4 (50%)
Ig strand G 7135..7138 CDD:409353 1/2 (50%)
Ig 7173..7232 CDD:409353 20/64 (31%)
Ig strand C 7184..7188 CDD:409353 0/3 (0%)
Ig strand E 7210..7214 CDD:409353 1/3 (33%)
Ig strand F 7224..7229 CDD:409353 2/9 (22%)
IG_like 7406..7475 CDD:214653 17/94 (18%)
Ig strand B 7413..7417 CDD:409353 0/3 (0%)
Ig strand C 7426..7430 CDD:409353 0/3 (0%)
Ig strand E 7451..7455 CDD:409353 1/3 (33%)
Ig strand F 7465..7470 CDD:409353 2/17 (12%)
FN3 7489..7588 CDD:238020 26/112 (23%)
STKc_MLCK 7626..7876 CDD:271005 23/119 (19%)
obsl1XP_031749624.1 IG_like 28..112 CDD:214653 23/84 (27%)
Ig strand B 39..43 CDD:409353 1/3 (33%)
Ig strand C 52..56 CDD:409353 1/3 (33%)
Ig strand E 78..82 CDD:409353 1/3 (33%)
Ig strand F 92..97 CDD:409353 2/4 (50%)
Ig strand G 105..108 CDD:409353 0/2 (0%)
I-set 192..282 CDD:400151 27/93 (29%)
Ig strand B 209..213 CDD:409353 1/3 (33%)
Ig strand C 222..226 CDD:409353 1/3 (33%)
Ig strand E 248..252 CDD:409353 1/3 (33%)
Ig strand F 262..267 CDD:409353 2/4 (50%)
Ig strand G 275..278 CDD:409353 0/2 (0%)
Ig_3 305..372 CDD:464046 20/66 (30%)
Ig 391..461 CDD:472250 17/69 (25%)
Ig strand B 407..411 CDD:409353 2/3 (67%)
Ig strand C 418..422 CDD:409353 1/3 (33%)
Ig strand E 443..447 CDD:409353 2/3 (67%)
Ig strand F 457..462 CDD:409353 1/4 (25%)
Ig 477..561 CDD:472250 21/95 (22%)
Ig strand B 494..497 CDD:409353 0/2 (0%)
Ig strand C 506..510 CDD:409353 2/9 (22%)
Ig strand E 531..535 CDD:409353 3/8 (38%)
Ig strand G 554..557 CDD:409353 0/2 (0%)
Ig 582..653 CDD:472250 23/81 (28%)
Ig strand B 586..590 CDD:409353 2/3 (67%)
Ig strand C 598..602 CDD:409353 0/3 (0%)
Ig strand E 623..627 CDD:409353 1/3 (33%)
Ig strand F 637..642 CDD:409353 3/5 (60%)
Ig strand G 646..649 CDD:409353 0/2 (0%)
Ig 673..744 CDD:472250 20/96 (21%)
Ig strand B 677..681 CDD:409353 2/3 (67%)
Ig strand C 689..693 CDD:409353 0/3 (0%)
Ig strand E 714..718 CDD:409353 1/3 (33%)
Ig strand F 728..733 CDD:409353 1/4 (25%)
Ig strand G 737..740 CDD:409353 0/25 (0%)
Ig 765..835 CDD:472250 19/77 (25%)
Ig strand B 768..772 CDD:409353 1/3 (33%)
Ig strand C 780..784 CDD:409353 1/3 (33%)
Ig strand E 805..809 CDD:409353 1/3 (33%)
Ig strand F 819..824 CDD:409353 1/4 (25%)
Ig strand G 828..831 CDD:409353 1/2 (50%)
Ig 856..926 CDD:472250 18/74 (24%)
Ig strand B 859..863 CDD:409353 1/3 (33%)
Ig strand C 871..875 CDD:409353 0/3 (0%)
Ig strand E 896..900 CDD:409353 1/3 (33%)
Ig strand F 910..915 CDD:409353 0/4 (0%)
Ig strand G 919..922 CDD:409353 1/2 (50%)
Ig 947..1017 CDD:472250 18/78 (23%)
Ig strand B 950..954 CDD:409353 0/3 (0%)
Ig strand C 962..966 CDD:409353 1/3 (33%)
Ig strand E 987..991 CDD:409353 0/3 (0%)
Ig strand F 1001..1006 CDD:409353 0/4 (0%)
Ig strand G 1010..1013 CDD:409353 1/2 (50%)
Ig 1030..1108 CDD:472250 10/77 (13%)
Ig strand B 1041..1045 CDD:409353 1/3 (33%)
Ig strand C 1053..1057 CDD:409353 0/3 (0%)
Ig strand E 1078..1082 CDD:409353 0/3 (0%)
Ig strand F 1092..1097 CDD:409353 1/4 (25%)
Ig strand G 1101..1104 CDD:409353 0/2 (0%)
Ig 1122..1198 CDD:472250 27/81 (33%)
Ig strand B 1131..1135 CDD:409353 2/3 (67%)
Ig strand C 1143..1147 CDD:409353 1/3 (33%)
Ig strand E 1168..1172 CDD:409353 1/3 (33%)
Ig strand F 1182..1187 CDD:409353 1/4 (25%)
Ig strand G 1191..1194 CDD:409353 1/2 (50%)
Ig 1211..1289 CDD:472250 24/90 (27%)
Ig strand B 1222..1226 CDD:409353 2/3 (67%)
Ig strand C 1234..1238 CDD:409353 1/4 (25%)
Ig strand E 1259..1263 CDD:409353 1/3 (33%)
Ig strand F 1273..1278 CDD:409353 1/8 (13%)
Ig strand G 1282..1285 CDD:409353 1/2 (50%)
Ig 1310..1380 CDD:472250 23/90 (26%)
Ig strand B 1313..1317 CDD:409353 1/3 (33%)
Ig strand C 1325..1329 CDD:409353 1/3 (33%)
Ig strand E 1350..1354 CDD:409353 1/3 (33%)
Ig strand F 1364..1369 CDD:409353 3/22 (14%)
Ig strand G 1373..1376 CDD:409353 1/2 (50%)
Ig 1401..1463 CDD:472250 21/70 (30%)
Ig strand B 1404..1408 CDD:409353 1/3 (33%)
Ig strand C 1416..1420 CDD:409353 1/3 (33%)
Ig strand E 1441..1445 CDD:409353 2/3 (67%)
Ig strand F 1455..1460 CDD:409353 1/9 (11%)
Ig 1493..1563 CDD:472250 20/76 (26%)
Ig strand B 1496..1500 CDD:409353 1/3 (33%)
Ig strand C 1508..1512 CDD:409353 0/3 (0%)
Ig strand E 1533..1537 CDD:409353 1/3 (33%)
Ig strand F 1547..1552 CDD:409353 3/4 (75%)
Ig strand G 1556..1559 CDD:409353 2/2 (100%)
Ig 1585..1655 CDD:472250 20/86 (23%)
Ig strand B 1588..1592 CDD:409353 0/3 (0%)
Ig strand C 1600..1604 CDD:409353 0/3 (0%)
Ig strand E 1625..1629 CDD:409353 0/3 (0%)
Ig strand F 1639..1644 CDD:409353 1/4 (25%)
Ig strand G 1648..1651 CDD:409353 1/2 (50%)
Ig 1679..1747 CDD:472250 19/74 (26%)
Ig strand B 1680..1684 CDD:409353 1/5 (20%)
Ig strand C 1692..1696 CDD:409353 2/3 (67%)
Ig strand E 1717..1721 CDD:409353 1/3 (33%)
Ig strand F 1731..1736 CDD:409353 2/4 (50%)
Ig strand G 1740..1743 CDD:409353 0/2 (0%)
Ig 1769..1839 CDD:472250 24/72 (33%)
Ig strand B 1772..1776 CDD:409353 1/3 (33%)
Ig strand C 1784..1788 CDD:409353 0/3 (0%)
Ig strand E 1809..1813 CDD:409353 2/4 (50%)
Ig strand F 1823..1828 CDD:409353 2/4 (50%)
Ig strand G 1832..1835 CDD:409353 1/2 (50%)
Ig 1846..1919 CDD:472250 11/72 (15%)
Ig strand B 1862..1866 CDD:143224 0/3 (0%)
Ig strand C 1874..1878 CDD:143224 0/3 (0%)
Ig strand E 1899..1903 CDD:143224 2/3 (67%)
Ig strand G 1931..1934 CDD:143224 1/2 (50%)
Ig 1936..2005 CDD:472250 15/90 (17%)
Ig strand B 1951..1955 CDD:409353 1/20 (5%)
Ig strand C 1963..1967 CDD:409353 1/3 (33%)
Ig strand E 1988..1992 CDD:409353 1/3 (33%)
Ig strand F 2002..2007 CDD:409353 1/4 (25%)
Ig strand G 2011..2014 CDD:409353 0/2 (0%)
Ig 2114..2183 CDD:472250 16/69 (23%)
Ig strand B 2129..2133 CDD:409353 0/3 (0%)
Ig strand C 2141..2145 CDD:409353 0/3 (0%)
Ig strand E 2166..2170 CDD:409353 1/3 (33%)
Ig strand F 2180..2185 CDD:409353 1/14 (7%)
Ig 2201..2274 CDD:472250 20/99 (20%)
Ig strand B 2218..2222 CDD:409353 0/3 (0%)
Ig strand C 2230..2234 CDD:409353 1/3 (33%)
Ig strand E 2255..2259 CDD:409353 1/3 (33%)
Ig strand F 2269..2274 CDD:409353 1/8 (13%)
Ig 2289..2374 CDD:472250 20/93 (22%)
Ig strand B 2307..2311 CDD:409353 0/3 (0%)
Ig strand C 2319..2323 CDD:409353 2/4 (50%)
Ig strand E 2344..2348 CDD:409353 0/3 (0%)
Ig strand G 2367..2370 CDD:409353 2/2 (100%)
Ig 2380..2464 CDD:472250
Ig strand B 2397..2400 CDD:409353
Ig strand E 2434..2438 CDD:409353
Ig strand G 2457..2460 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.