DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4aa1 and CYP72C1

DIOPT Version :9

Sequence 1:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:305 Identity:64/305 - (20%)
Similarity:109/305 - (35%) Gaps:97/305 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PPSLPFLGNCMLVTDKDLMRRCAGKAFDLYGSLVRIWVLLFPFFAVLEPEDLQVILSSKKHTNKV 115
            |..:|||.:.:|...|        |.|..||.        :|...|::||.|:.|:|..:...|.
plant    81 PRMMPFLHHTVLKHGK--------KCFTWYGP--------YPNVIVMDPETLREIMSKHELFPKP 129

  Fly   116 FFYRLMHNFLGDGLITSSGSKWSNHRRLIQPAFHHNLLEKFIDTFVDASQSLYENLD--AEAVGT 178
            ......|.|| .||:...|.|||.||.::.|||..:.|:..:..|..:.:.:.|..:  |.|.||
plant   130 KIGSHNHVFL-SGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGT 193

  Fly   179 -EINIAKYVNNCVLDILNEAVLG---------VPIKKRGQDVAMME-DSPFRQGKIMMPARFTQP 232
             |::...:.::...::|..|..|         ..|::...|:.::. .:.:..|...:|.:|   
plant   194 MELDSWTHCHDLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRAVYIPGSKFLPTKF--- 255

  Fly   233 WLLLDGIYHWTKMANDELNQKKRLNDFTRKMIQRRRQIQNNNNGNSERKCLLDHMIEISESNRDF 297
                                .:||.:..|.|                 :.:...|||        
plant   256 --------------------NRRLRETERDM-----------------RAMFKAMIE-------- 275

  Fly   298 TEEDIVNEACTFMLAGQDSVGAAVAFTLFLLTQNPECQDRCVLEL 342
            |:|:.:...     .|.|              :|.:|..||.|.:
plant   276 TKEEEIKRG-----RGTD--------------KNSDCCSRCWLRI 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 64/305 (21%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.