DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4aa1 and CYP72A14

DIOPT Version :9

Sequence 1:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_188086.1 Gene:CYP72A14 / 820696 AraportID:AT3G14680 Length:512 Species:Arabidopsis thaliana


Alignment Length:507 Identity:128/507 - (25%)
Similarity:226/507 - (44%) Gaps:82/507 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FVEKVLERTTNLELCSILILLVISLSIYTFYATLNTYLRSVLLSLRLTGPPSLPFLGNCMLVTDK 66
            |..|:|||:...:          .||..::...:..:.:.:.:.:..|..|..|        || 
plant    30 FTPKMLERSLRRQ----------GLSGTSYTPLIGDFKKMISMFIEATSKPIKP--------TD- 75

  Fly    67 DLMRRCAGKAFDL---YGSLVRIWVLLFPFFAVLEPEDLQVILSSKKHTNKVFFYRLMHNF---- 124
            |:..|.......:   :|.....|....|...:::||.::.:.      |||:.::..|.|    
plant    76 DITPRVMPHPLQMLKTHGRTNLTWFGPIPTITIMDPEQIKEVF------NKVYDFQKAHTFPLSK 134

  Fly   125 -LGDGLITSSGSKWSNHRRLIQPAFHHNLLEKFIDTFVDASQSLYENLDA----EAVGTEINIAK 184
             ||.||::..|.||:.|||:|.||||...::..:..|.::...|....|.    :....|:::..
plant   135 ILGTGLVSYDGDKWAQHRRIINPAFHLEKIKNMVHVFHESCSELVGEWDKLVSDKGSSCEVDVWP 199

  Fly   185 YVNNCVLDILNEAVLGVPIKKRGQDVAMMEDSPFRQG-----------KIMMPARFTQPWLLLDG 238
            .:.:...|:::....|               |.:|:|           :::|.|  .|.:.:...
plant   200 GLTSMTADVISRTAFG---------------SSYREGHRIFELQAELAQLVMQA--FQKFFIPGY 247

  Fly   239 IYHWTKMANDELNQKKRLNDFTRKMIQRRRQIQNNNNGNSERKCLLDHMIEISESNRDFTE---- 299
            ||..||.........:.:.|..|.:|.:|.:.:.:....||     |.:..:.|||...||    
plant   248 IYLPTKGNRRMKTAAREIQDILRGIINKRERARESGEAPSE-----DLLGILLESNLGQTEGNGM 307

  Fly   300 --EDIVNEACTFMLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAPTMTDLHEMR 362
              ||::.|...|.||||::....:.:|:.||:|:.:.|.|...|:..:|.|  :.|....|::::
plant   308 STEDMMEECKLFYLAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGD--KQPDTEGLNQLK 370

  Fly   363 YMEMCIKEALRLYPSVPLIARKLGEEVRLAKHTLPAGSNVFICPYATHRLAHIY-PDPEKFQPER 426
            .|.|.:.|.|||||.|..:.|.:.:|::|...|||.|..:.:.....||...:: .|..:|:|||
plant   371 VMTMILYEVLRLYPPVVQLTRAIHKEMKLGDLTLPGGVQISLPVLLVHRDTELWGNDAGEFKPER 435

  Fly   427 FSPENSE-NRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLR--SYQLLP 475
            |....|: .::..:|.||:.|||.|||..|.::|.|..:|.:|:  |::|.|
plant   436 FKDGLSKATKNQVSFFPFAWGPRICIGQNFTLLEAKMAMSLILQRFSFELSP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 119/457 (26%)
CYP72A14NP_188086.1 p450 24..512 CDD:299894 128/507 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.