DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4aa1 and CYP4F11

DIOPT Version :9

Sequence 1:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:530 Identity:158/530 - (29%)
Similarity:256/530 - (48%) Gaps:65/530 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LILLVISLS---------IYTFYATLNTYLRSVLLSLRLTGPPSLP----FLGNCMLVTDKDLMR 70
            |:||::..|         .||||....          ||...|..|    |.|:..|||..:...
Human    20 LLLLLVGGSWLLARVLAWTYTFYDNCR----------RLQCFPQPPKQNWFWGHQGLVTPTEEGM 74

  Fly    71 RCAGKAFDLYGSLVRIWV-LLFPFFAVLEPEDLQVILSSKKHT--NKVFFYRLMHNFLGDGLITS 132
            :...:....|....::|: ..||...:..|:.::.|.|:....  ..:.||..:..:|||||:.|
Human    75 KTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLS 139

  Fly   133 SGSKWSNHRRLIQPAFHHNLLEKFIDTF---VDASQSLYENLDAEAVGTEINIAKYVNNCVLDIL 194
            .|.|||.|||::.||||.|:|:.::..|   |:.....::.|.:|. ...:::.::::...||.|
Human   140 GGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEG-SARLDMFEHISLMTLDSL 203

  Fly   195 NEAVLGVPIKKRGQD------VAMMEDSPFRQGKIMMPARFTQPWLLLDGIYHWTKMANDELNQK 253
            .:.|..  .:...|:      .|::|.|.|      :..|..|..|..|.:|:.|..........
Human   204 QKCVFS--FESNCQEKPSEYIAAILELSAF------VEKRNQQILLHTDFLYYLTPDGQRFRRAC 260

  Fly   254 KRLNDFTRKMIQRRR-----QIQNNNNGNSERKCLLDH----MIEISESNRDFTEEDIVNEACTF 309
            ..::|||..:||.||     |..::...|..:...||.    ::...|..::.::|||..||.||
Human   261 HLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTF 325

  Fly   310 MLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAP---TMTDLHEMRYMEMCIKEA 371
            |..|.|:..:.:::.|:.|.::||.|::|..|:..:.:|  |.|   ...||.::.::.|||||:
Human   326 MFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKD--REPIEIEWDDLAQLPFLTMCIKES 388

  Fly   372 LRLYPSVPLIARKLGEEVRLAK-HTLPAGSNVFICPYATHRLAHIYPDPEKFQPERFSPENSENR 435
            |||:|.||:|:|...::..|.. ..:|.|....|.....|....::||||.:.|.||..||.:.|
Human   389 LRLHPPVPVISRCCTQDFVLPDGRVIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFDQENIKER 453

  Fly   436 HPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSYQLLPVTGKTTIAATFRITLRASGGLWVRL 500
            .|.||:|||||||.|||..||:.|:|.:::..|..:::||.  .|.......:.|||.||||:|:
Human   454 SPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILPT--HTEPRRKPELILRAEGGLWLRV 516

  Fly   501 KERDHPLIAH 510
            :    ||.|:
Human   517 E----PLGAN 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 134/453 (30%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 137/466 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.