DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4aa1 and Cyp26c1

DIOPT Version :9

Sequence 1:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001098671.1 Gene:Cyp26c1 / 546726 MGIID:2679699 Length:518 Species:Mus musculus


Alignment Length:517 Identity:113/517 - (21%)
Similarity:193/517 - (37%) Gaps:122/517 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LCSILILLVISLSIYTFYATLNTYLRSVLLSLRLTGPPSLPFLGNCM--LVTDKDLMRRCAGKAF 77
            ||:.| ||.::..::|...||:....|.|...:  |....||.|..:  ||         .|..|
Mouse    20 LCAGL-LLGLAQQLWTLRWTLSRDWASTLPLPK--GSMGWPFFGETLHWLV---------QGSRF 72

  Fly    78 -----DLYGSLVRIWVLLFPFFAVLEPEDLQVILSSKKHTNKVFFYRLMHNFLGD-GLITSSGSK 136
                 :.||::.:..:|..|...|...|:::.||..:....:..:.:..|..||. .|:.:.|..
Mouse    73 HSSRRERYGTVFKTHLLGRPVIRVSGAENVRTILLGEHRLVRSQWPQSAHILLGSHTLLGAVGEP 137

  Fly   137 WSNHRRLIQPAFHHNLLEKFID--------------------TFVDASQSLYENLDAE-AVGTEI 180
            ....|:::...|..:.||:|:.                    ....|:::|...:.|. .:|.::
Mouse   138 HRQRRKVLARVFSRSSLEQFVPRLQGALRREVRSWCAAQRPVAVYQAAKALTFRMAARILLGLQL 202

  Fly   181 NIAKYVNNC-----VLDILNEAVLGVPIKKRGQDVAMMEDSPFRQGKIMMPARFTQPWLLLDGIY 240
            :.|:    |     ..:.|.|.:..:|:           |.||..              |..|| 
Mouse   203 DEAR----CTELAHTFEQLVENLFSLPL-----------DVPFSG--------------LRKGI- 237

  Fly   241 HWTKMANDELNQKKRLNDFTRKMIQRRRQIQNNNNGNSERKCLLDHMIEISESNRDFTEEDIVNE 305
                .|.|:|.:  .|::...:.:|.::..:..           |.::.|..|.|:...|..|.|
Mouse   238 ----RARDQLYE--HLDEAVAEKLQEKQTAEPG-----------DALLLIINSARELGHEPSVQE 285

  Fly   306 ----ACTFMLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAPTMTD--------- 357
                |...:.|...:..:|....:.||.|:|....:...||:.  :...||.|.|.         
Mouse   286 LKELAVELLFAAFFTTASASTSLILLLLQHPAAITKIQQELSA--QGLGRACTCTPRASGSPPDC 348

  Fly   358 ----------LHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAKHTLPAGSNVFICPYATHRL 412
                      |..:||::..:||.|||.|.|....|.......|..:.:|.|.:|......||..
Mouse   349 GCEPDLSLAMLGRLRYVDCVVKEVLRLLPPVSGGYRTALRTFELDGYQIPKGWSVMYSIRDTHET 413

  Fly   413 AHIY-PDPEKFQPERFSPENSENRHP---YAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRS 470
            |.:| ..||.|.||||..|:.:.|..   :.::||..|.|.|:|...|...::.:...|:|:
Mouse   414 AAVYRSPPEGFDPERFGVESGDARGSGGRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRT 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 103/482 (21%)
Cyp26c1NP_001098671.1 p450 40..500 CDD:386267 105/496 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.