DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4aa1 and Cyp313a1

DIOPT Version :9

Sequence 1:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster


Alignment Length:512 Identity:133/512 - (25%)
Similarity:241/512 - (47%) Gaps:44/512 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LCSILILLVISLSIYTFYATLNTYLRSVLLSLRLTGPPSLPFLGNCM--LVTDKDLMRRCA--GK 75
            :.:|.:||.:....:.::  |.:..|...|.|::.||..||.||:.:  ::|.|   |:.:  .|
  Fly     1 MLTINLLLAVGALFWIYF--LWSRRRLYFLMLKIPGPIGLPILGSSLENIITYK---RKLSFRTK 60

  Fly    76 AFDLYGSLVRIWVLLFPFFAVLEPEDLQVILSSKK-HTNKVFFYRLMHNFLGDGLITSSGSKWSN 139
            ..:.|||.:..|:...||....:|:.::.|.||.. |.........:.:.:|:||:......|.:
  Fly    61 YLNKYGSTILTWMGPVPFIVTRDPKVVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLD 125

  Fly   140 HRRLIQPAFHHNLLEKFIDTFVDASQSLYENLDAEAVGTEINIAKYVNNCVLDILNEAVLGVPIK 204
            .|:...|:|..:||..|...|...::.|...||......||::...:......|..:..:|..:|
  Fly   126 RRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVK 190

  Fly   205 KRGQDVAMMEDSPFRQG---------------KIMMPARFTQPWLLLDGIYHWTKMANDELNQKK 254
                     .|..|:.|               .|:||....:   ::..|..:.|:..|..::.:
  Fly   191 ---------HDEHFKNGSLVESFESLISHSTLNILMPLVQNR---MISKICGYDKLRADNFSRIQ 243

  Fly   255 RLNDFTRKMIQRRRQIQNNNNGNSERKCLLDHMIEISESNRDFTEEDIVNEACTFMLAGQDSVGA 319
            ::.|   .::.::.......:.:.|...:::..:|:.... |.|..|:.:|.|..:.||.|:...
  Fly   244 KMLD---NVVNKKVNPLPKTDSDPESNIVINRAMELYRKG-DITYMDVKSECCIMIAAGYDTSAL 304

  Fly   320 AVAFTLFLLTQNPECQDRCVLELATIFEDSNR-APTMTDLHEMRYMEMCIKEALRLYPSVPLIAR 383
            .|...||||..:||.|:....||..:|.|:.. ..|..|:.::.|:|..|||.|||.|::|:.||
  Fly   305 TVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYLERVIKETLRLIPAIPITAR 369

  Fly   384 KLGEEVRLAKHTL-PAGSNVFICPYATHRLAHIY-PDPEKFQPERFSPENSENRHPYAFLPFSAG 446
            :...:|||:...| |.|..:.|..:.|||...:: ||.:.|.|:.|..||.|.:||||::||:.|
  Fly   370 ETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPYAYIPFARG 434

  Fly   447 PRYCIGNRFAIMEIKTIVSRLLRSYQLLPVTGKTTIAATFRITLRASGGLWVRLKER 503
            .|.|||:::|:|..|..:.|:||:|::...|....:.....:|::.:....::|:.|
  Fly   435 KRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPRLKLQRR 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 122/447 (27%)
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 122/448 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I1639
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1194
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
54.960

Return to query results.
Submit another query.