DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4aa1 and CYP4F3

DIOPT Version :9

Sequence 1:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:534 Identity:160/534 - (29%)
Similarity:261/534 - (48%) Gaps:87/534 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LILLVISLS---------IYTFYATLNTYLRSVLLSLRLTGPPSLP----FLGNCMLVTDKD--- 67
            |:||::..|         .||||..          ..||...|..|    |||:..|:...:   
Human    20 LLLLLVGASWLLARILAWTYTFYDN----------CCRLRCFPQPPKRNWFLGHLGLIHSSEEGL 74

  Fly    68 LMRRCAGKAF-DL-------YGSLVRIW-------VLLFPFFAVLEPEDLQVILSSKKHTNKVFF 117
            |..:.....| |:       :.::|||:       ||..|  |.:.|:|            || |
Human    75 LYTQSLACTFGDMCCWWVGPWHAIVRIFHPTYIKPVLFAP--AAIVPKD------------KV-F 124

  Fly   118 YRLMHNFLGDGLITSSGSKWSNHRRLIQPAFHHNLLEKFIDTF---VDASQSLYENLDAEAVGTE 179
            |..:..:|||||:.|:|.|||.|||::.||||.|:|:.::..|   |:...:.::.|.:|. ...
Human   125 YSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEG-SAR 188

  Fly   180 INIAKYVNNCVLDILNEAVLGVPI----KKRGQDVAMMEDSPFRQGKIMMPARFTQPWLLLDGIY 240
            :::.::::...||.|.:.|.....    |......|::|.|      .::..|..|..|.:|.:|
Human   189 LDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELS------ALVTKRHQQILLYIDFLY 247

  Fly   241 HWTKMANDELNQKKRLNDFTRKMIQRRRQ------IQNNNNGNSERKCL--LD-HMIEISESNRD 296
            :.|..........:.::|||..:||.||:      :.:.....::.|.|  :| .::...|..:.
Human   248 YLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKK 312

  Fly   297 FTEEDIVNEACTFMLAGQDSVGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAP---TMTDL 358
            .::|||..||.|||..|.|:..:.:::.|:.|.::||.|:||..|:..:.:|  |.|   ...||
Human   313 LSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKD--REPKEIEWDDL 375

  Fly   359 HEMRYMEMCIKEALRLYPSVPLIARKLGEEVRLAK-HTLPAGSNVFICPYATHRLAHIYPDPEKF 422
            .::.::.|||||:|||:|.||.::|...:::.|.. ..:|.|....|..:.||....::||||.:
Human   376 AQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVY 440

  Fly   423 QPERFSPENSENRHPYAFLPFSAGPRYCIGNRFAIMEIKTIVSRLLRSYQLLPVTGKTTIAATFR 487
            .|.||.|:|.:.|.|.||:|||||||.|||..||:.|:|.::...|..:::||  ..|.......
Human   441 DPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLP--DHTEPRRKPE 503

  Fly   488 ITLRASGGLWVRLK 501
            :.|||.||||:|::
Human   504 LVLRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 139/466 (30%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 149/488 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.