DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4aa1 and CYP4V2

DIOPT Version :9

Sequence 1:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_997235.3 Gene:CYP4V2 / 285440 HGNCID:23198 Length:525 Species:Homo sapiens


Alignment Length:438 Identity:163/438 - (37%)
Similarity:248/438 - (56%) Gaps:21/438 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LVRIWVLLFPFFAVLEPEDLQVILSSKKHTNKVFFYRLMHNFLGDGLITSSGSKWSNHRRLIQPA 147
            |:::||...|..|:...|:::|||:|.|..:|...|:.:..:||.||:||:|:||.:.|:::.|.
Human    89 LLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPT 153

  Fly   148 FHHNLLEKFIDTFVDASQSLYENLDAEAVGTEINIAKYVNNCVLDILNEAVLGVPIKKRGQDVAM 212
            ||..:||.|:|...:.:..|.:.|:........|...|:..|.|||:.|..:|..|..:..|.:.
Human   154 FHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSE 218

  Fly   213 MEDSPFRQGKIMMPARFTQPWLLLDGIYHWTKMANDELNQKKR---LNDFTRKMIQRRRQIQNNN 274
            ...:.:|..: |:..|...|||.||   .|..|..:....||.   |:.||..:|..|....|.|
Human   219 YVRAVYRMSE-MIFRRIKMPWLWLD---LWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNAN 279

  Fly   275 N-----------GNSERKCLLDHMIEIS--ESNRDFTEEDIVNEACTFMLAGQDSVGAAVAFTLF 326
            .           ..::|:..||.::.::  |.|| .:.|||..|..|||..|.|:..||:.::|:
Human   280 EDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNR-LSHEDIREEVDTFMFEGHDTTAAAINWSLY 343

  Fly   327 LLTQNPECQDRCVLELATIFEDSNRAPTMTDLHEMRYMEMCIKEALRLYPSVPLIARKLGEEVRL 391
            ||..|||.|.:...||..:|..|:|..|:.||.::||:|..|||.|||:|||||.||.:.|:..:
Human   344 LLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEV 408

  Fly   392 AKHTLPAGSNVFICPYATHRLAHIYPDPEKFQPERFSPENSENRHPYAFLPFSAGPRYCIGNRFA 456
            |.:.:..|:...|.|||.||....:|:||:||||||.|||::.|||||::|||||||.|||.:||
Human   409 AGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFA 473

  Fly   457 IMEIKTIVSRLLRSYQLLPVTGKTTIAATFRITLRASGGLWVRLKERD 504
            :||.|||:|.:||.:.:.....:..:....::.||.|.|:|::||.|:
Human   474 VMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRN 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 155/407 (38%)
CYP4V2NP_997235.3 p450 55..517 CDD:278495 160/432 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 1 1.100 - - O PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.