DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4aa1 and Cyp4f6

DIOPT Version :9

Sequence 1:NP_611067.2 Gene:Cyp4aa1 / 36752 FlyBaseID:FBgn0034053 Length:510 Species:Drosophila melanogaster
Sequence 2:XP_006241111.1 Gene:Cyp4f6 / 266689 RGDID:708365 Length:538 Species:Rattus norvegicus


Alignment Length:530 Identity:160/530 - (30%)
Similarity:266/530 - (50%) Gaps:65/530 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ILLVISLSIYTFYATLNTYLRSVLLSLRLTGPPSLP--FLGNCMLV-TDKDLMRRCA--GKAF-D 78
            ||..|...|||||..        ...||....|..|  |.|:..|: .:::.|:..|  |:.| |
  Rat    31 ILARILAWIYTFYDN--------CCRLRCFPQPPKPSWFWGHLTLMKNNEEGMQFIAHLGRNFRD 87

  Fly    79 LYGSLVRIWV-LLFPFFAVLEPEDLQVIL--SSKKHTNKVFFYRLMHNFLGDGLITSSGSKWSNH 140
            ::.|    || .::|...::.|..:..:|  |:.....::..|..:..:|||||:.|:|.||::|
  Rat    88 IHLS----WVGPVYPILRLVHPNVIAPLLQASAAVAPKEMTLYGFLKPWLGDGLLMSAGEKWNHH 148

  Fly   141 RRLIQPAFHHNLLEKFIDTF---VDASQSLYENLDAEAVGTEINIAKYVNNCVLDILNEAVLGVP 202
            |||:.||||.::|:.::..|   |:...:.::.|.|:. ...:::.::::...||.|.:.:....
  Rat   149 RRLLTPAFHFDILKSYVKIFNKSVNTMHAKWQRLTAKG-SARLDMFEHISLMTLDSLQKCIFSFD 212

  Fly   203 IKKRGQD----VAMMEDSPFRQGKIMMPARFTQPWLLLDGIYHWTKMANDELNQKKR---LNDFT 260
            ...:..:    .|::|.|.      ::..|..||:|.||.:|:.|.   |....:|.   :::||
  Rat   213 SNCQESNSEYIAAILELSS------LIVKRQRQPFLYLDFLYYLTA---DGRRFRKACDVVHNFT 268

  Fly   261 RKMIQRRRQIQNNNNGNSERKC-----LLDH----MIEISESNRDFTEEDIVNEACTFMLAGQDS 316
            ..:|:.||...|....:...|.     .||.    ::...|..:..::.||..||.|||..|.|:
  Rat   269 DAVIRERRSTLNTQGVDEFLKARAKTKTLDFIDVLLLAKDEHGKGLSDVDIRAEADTFMFGGHDT 333

  Fly   317 VGAAVAFTLFLLTQNPECQDRCVLELATIFEDSNRAP---TMTDLHEMRYMEMCIKEALRLYPSV 378
            ..:|:::.|:.|.::||.|:||..|:..:..|  |.|   ...||.::.::.|||||:|||:|.|
  Rat   334 TASALSWILYNLARHPEYQERCRQEVRELLRD--REPEEIEWDDLAQLPFLTMCIKESLRLHPPV 396

  Fly   379 PLIARKLGEEVRLAK-HTLPAGSNVFICPYATHRLAHIYPDPEKFQPERFSPENSENRHPYAFLP 442
            .||:|...:::.|.. ..:|.|:...|..:..|....::||||.:.|.||.|||.:.|.|.||:|
  Rat   397 LLISRCCSQDIVLPDGRVIPKGNICVISIFGVHHNPSVWPDPEVYNPFRFDPENPQKRSPLAFIP 461

  Fly   443 FSAGPRYCIGNRFAIMEIKTIVSRLLRSYQLLPVTGKTTIAATFRITLRASGGLWVRLK------ 501
            ||||||.|||..||:.|||..::..|..:.:||...:.....  .:.|||.||||:|::      
  Rat   462 FSAGPRNCIGQTFAMSEIKVALALTLLRFCVLPDDKEPRRKP--ELILRAEGGLWLRVEPLSTVT 524

  Fly   502 -ERDHPLIAH 510
             :....|:||
  Rat   525 SQLPWDLLAH 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4aa1NP_611067.2 p450 50..475 CDD:278495 137/456 (30%)
Cyp4f6XP_006241111.1 p450 53..515 CDD:278495 145/479 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.